SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602830|ref|NP_245902.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602830|ref|NP_245902.1|
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily Pili subunits 0.0000000133
Family Pilin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602830|ref|NP_245902.1|
Sequence length 175
Comment hypothetical protein PM0965 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKRGFTLLEILMVLLLISSMLLVVLPNWTRVIDFISFEQEQRQLWIFLRQLQTRVATSGQ
VWFLIANRDVNRQHWCLTAQLKSEYICDCFAPQHCPQRLSAQFYSSHFTGYTMLKTKHYY
PNTMTRLSAVRDTLETTCFVLQTDYQKAIFSLFNVGSIKLKKEASLSACEHNKEN
Download sequence
Identical sequences A0A1D2NXV4 A0A2K2Z1B1 Q9CM72
WP_005722914.1.11014 WP_005722914.1.11214 WP_005722914.1.11947 WP_005722914.1.12156 WP_005722914.1.12311 WP_005722914.1.14908 WP_005722914.1.15732 WP_005722914.1.17980 WP_005722914.1.19996 WP_005722914.1.24757 WP_005722914.1.27664 WP_005722914.1.28084 WP_005722914.1.35562 WP_005722914.1.3807 WP_005722914.1.38246 WP_005722914.1.3839 WP_005722914.1.3957 WP_005722914.1.40210 WP_005722914.1.40787 WP_005722914.1.41351 WP_005722914.1.41667 WP_005722914.1.42469 WP_005722914.1.43687 WP_005722914.1.45422 WP_005722914.1.4808 WP_005722914.1.49053 WP_005722914.1.52585 WP_005722914.1.52859 WP_005722914.1.53852 WP_005722914.1.55074 WP_005722914.1.55401 WP_005722914.1.58111 WP_005722914.1.58257 WP_005722914.1.60478 WP_005722914.1.61098 WP_005722914.1.6219 WP_005722914.1.62389 WP_005722914.1.6332 WP_005722914.1.63549 WP_005722914.1.66990 WP_005722914.1.70689 WP_005722914.1.72215 WP_005722914.1.78987 WP_005722914.1.79347 WP_005722914.1.79593 WP_005722914.1.81885 WP_005722914.1.8281 WP_005722914.1.83579 WP_005722914.1.88402 WP_005722914.1.89773 WP_005722914.1.90578 WP_005722914.1.92478 WP_005722914.1.93940 WP_005722914.1.9746 WP_005722914.1.9947 272843.PM0965 gi|15602830|ref|NP_245902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]