SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602843|ref|NP_245915.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602843|ref|NP_245915.1|
Domain Number 1 Region: 3-156
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.57e-54
Family RuvC resolvase 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602843|ref|NP_245915.1|
Sequence length 190
Comment Holliday junction resolvase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAIILGIDPGSRVTGYGVIRQAGRHLEYLGSGVIRTSVTDLPTRLKRIYMGVNEIILQYQ
PDMFAIEEVFLAKNANSALKLGQARGAAIVAAVNHDLPVFEYAARLVKQTVVGIGSADKI
QVQDMVTRILTLSEKPQADAADALAIAITHAHSLQHAFHVTNSAQATEKPEKTTALLKAR
YSRGRFRLKI
Download sequence
Identical sequences A0A1E3XKS6 P57894 V4N5Z3
gi|15602843|ref|NP_245915.1| gi|378773868|ref|YP_005176111.1| WP_005751719.1.10027 WP_005751719.1.10721 WP_005751719.1.11014 WP_005751719.1.11214 WP_005751719.1.11947 WP_005751719.1.12156 WP_005751719.1.12311 WP_005751719.1.1307 WP_005751719.1.14908 WP_005751719.1.15732 WP_005751719.1.17217 WP_005751719.1.17980 WP_005751719.1.18123 WP_005751719.1.19996 WP_005751719.1.20287 WP_005751719.1.21657 WP_005751719.1.22153 WP_005751719.1.2313 WP_005751719.1.23830 WP_005751719.1.24757 WP_005751719.1.26616 WP_005751719.1.26777 WP_005751719.1.27416 WP_005751719.1.27592 WP_005751719.1.28084 WP_005751719.1.29697 WP_005751719.1.30617 WP_005751719.1.34253 WP_005751719.1.35562 WP_005751719.1.35978 WP_005751719.1.36022 WP_005751719.1.3807 WP_005751719.1.38246 WP_005751719.1.3839 WP_005751719.1.39152 WP_005751719.1.3957 WP_005751719.1.40210 WP_005751719.1.40787 WP_005751719.1.41351 WP_005751719.1.41462 WP_005751719.1.41657 WP_005751719.1.41667 WP_005751719.1.42469 WP_005751719.1.42512 WP_005751719.1.42943 WP_005751719.1.43687 WP_005751719.1.44741 WP_005751719.1.45422 WP_005751719.1.47685 WP_005751719.1.4808 WP_005751719.1.49053 WP_005751719.1.50853 WP_005751719.1.51342 WP_005751719.1.52066 WP_005751719.1.52585 WP_005751719.1.52859 WP_005751719.1.53852 WP_005751719.1.55074 WP_005751719.1.55401 WP_005751719.1.57420 WP_005751719.1.58111 WP_005751719.1.58257 WP_005751719.1.58450 WP_005751719.1.58628 WP_005751719.1.58910 WP_005751719.1.59455 WP_005751719.1.60478 WP_005751719.1.60664 WP_005751719.1.61098 WP_005751719.1.61860 WP_005751719.1.62016 WP_005751719.1.6219 WP_005751719.1.62389 WP_005751719.1.6332 WP_005751719.1.63549 WP_005751719.1.65482 WP_005751719.1.65878 WP_005751719.1.66934 WP_005751719.1.66990 WP_005751719.1.72215 WP_005751719.1.73917 WP_005751719.1.74955 WP_005751719.1.75804 WP_005751719.1.78987 WP_005751719.1.79347 WP_005751719.1.79593 WP_005751719.1.80223 WP_005751719.1.80589 WP_005751719.1.80911 WP_005751719.1.81885 WP_005751719.1.8281 WP_005751719.1.83579 WP_005751719.1.86541 WP_005751719.1.87897 WP_005751719.1.88402 WP_005751719.1.89773 WP_005751719.1.90081 WP_005751719.1.90179 WP_005751719.1.90578 WP_005751719.1.91495 WP_005751719.1.92478 WP_005751719.1.93940 WP_005751719.1.94432 WP_005751719.1.94435 WP_005751719.1.95718 WP_005751719.1.9746 WP_005751719.1.9947 gi|386833853|ref|YP_006239167.1| 272843.PM0978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]