SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602852|ref|NP_245924.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602852|ref|NP_245924.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.42e-36
Family Glyoxalase I (lactoylglutathione lyase) 0.00000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602852|ref|NP_245924.1|
Sequence length 135
Comment hypothetical protein PM0987 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRILHTMLRVTNLERSIQFYQQVLGMRLLRTSDNPEYKYTLAFLGYDDEENASVLELTYN
WGVTEYELGTAYGHIAIGVEDIYATCDAVRQAGGKITREPGPVKGGKTVIAFVEDPDGYK
IEFIENKHAQSGLGN
Download sequence
Identical sequences A0A1D7R3D9 J4SJS4 J6CVB7 Q9CM55 V4NDM7
272843.PM0987 gi|386833844|ref|YP_006239158.1| gi|15602852|ref|NP_245924.1| gi|378773859|ref|YP_005176102.1| WP_005717189.1.10027 WP_005717189.1.10721 WP_005717189.1.11214 WP_005717189.1.11947 WP_005717189.1.12156 WP_005717189.1.12311 WP_005717189.1.1307 WP_005717189.1.14908 WP_005717189.1.15732 WP_005717189.1.17217 WP_005717189.1.17980 WP_005717189.1.18123 WP_005717189.1.19996 WP_005717189.1.20287 WP_005717189.1.21657 WP_005717189.1.22153 WP_005717189.1.2313 WP_005717189.1.23830 WP_005717189.1.24757 WP_005717189.1.26616 WP_005717189.1.26777 WP_005717189.1.27416 WP_005717189.1.27592 WP_005717189.1.28084 WP_005717189.1.29697 WP_005717189.1.30617 WP_005717189.1.34253 WP_005717189.1.35562 WP_005717189.1.35978 WP_005717189.1.36022 WP_005717189.1.3807 WP_005717189.1.38246 WP_005717189.1.3839 WP_005717189.1.39152 WP_005717189.1.3957 WP_005717189.1.40210 WP_005717189.1.40787 WP_005717189.1.41351 WP_005717189.1.41462 WP_005717189.1.41657 WP_005717189.1.41667 WP_005717189.1.42512 WP_005717189.1.42943 WP_005717189.1.43687 WP_005717189.1.44741 WP_005717189.1.45422 WP_005717189.1.47685 WP_005717189.1.4808 WP_005717189.1.49053 WP_005717189.1.50853 WP_005717189.1.51342 WP_005717189.1.52066 WP_005717189.1.52585 WP_005717189.1.52859 WP_005717189.1.53852 WP_005717189.1.55074 WP_005717189.1.55401 WP_005717189.1.57420 WP_005717189.1.58111 WP_005717189.1.58257 WP_005717189.1.58450 WP_005717189.1.58628 WP_005717189.1.58910 WP_005717189.1.59455 WP_005717189.1.60478 WP_005717189.1.60664 WP_005717189.1.61098 WP_005717189.1.61860 WP_005717189.1.62016 WP_005717189.1.6219 WP_005717189.1.62389 WP_005717189.1.6332 WP_005717189.1.63549 WP_005717189.1.65482 WP_005717189.1.65878 WP_005717189.1.66934 WP_005717189.1.66990 WP_005717189.1.70689 WP_005717189.1.72215 WP_005717189.1.73917 WP_005717189.1.74955 WP_005717189.1.75804 WP_005717189.1.78987 WP_005717189.1.79347 WP_005717189.1.79593 WP_005717189.1.80223 WP_005717189.1.80589 WP_005717189.1.80911 WP_005717189.1.81885 WP_005717189.1.8281 WP_005717189.1.83579 WP_005717189.1.86541 WP_005717189.1.87897 WP_005717189.1.88402 WP_005717189.1.89773 WP_005717189.1.90081 WP_005717189.1.90179 WP_005717189.1.91495 WP_005717189.1.92478 WP_005717189.1.93940 WP_005717189.1.94432 WP_005717189.1.94435 WP_005717189.1.95718 WP_005717189.1.9746 WP_005717189.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]