SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602853|ref|NP_245925.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602853|ref|NP_245925.1|
Domain Number 1 Region: 13-210
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.54e-56
Family DnaQ-like 3'-5' exonuclease 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602853|ref|NP_245925.1|
Sequence length 220
Comment ribonuclease T [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTEIQAEATNTHLLKHRFRGYFPVIIDVETAGFNAKTDALLELAAITVKMNEDGLLVPDQ
TCHFHIEPFAGANINPESLQFNGIDIHNPLRGAVSETVAITELFKMVRKAQKAADCQRSI
IVAHNAAFDQSFLMAAAERTGVKRNPFHPFGMFDTATLSGFMFGQTVLVKACQAAQIAFD
GKQAHSALYDTERTAELFCYMVNHLKHLGGFPHQQANEKK
Download sequence
Identical sequences P57896
272843.PM0988 gi|15602853|ref|NP_245925.1| WP_010906953.1.12311 WP_010906953.1.15732 WP_010906953.1.19996 WP_010906953.1.21657 WP_010906953.1.40210 WP_010906953.1.45422 WP_010906953.1.4808 WP_010906953.1.51342 WP_010906953.1.53852 WP_010906953.1.6219 WP_010906953.1.62389 WP_010906953.1.66990 WP_010906953.1.81885 WP_010906953.1.8281 WP_010906953.1.89773 WP_010906953.1.9746 WP_010906953.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]