SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602858|ref|NP_245930.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602858|ref|NP_245930.1|
Domain Number 1 Region: 6-230
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.45e-75
Family Sir2 family of transcriptional regulators 0.0000000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602858|ref|NP_245930.1|
Sequence length 234
Comment NAD-dependent deacetylase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTKQVRIVVLTGAGISAESGIRTFRATDGLWENHPVDEVATPEGFARNPKLVQRFYNERR
KQLFSDQIAPNAAHFALAELEKKLGDNLLIVTQNVDNLHERAGSKNLIHMHGELLKVRCV
KSGKIYDWQGDIGEHDKCLCCTPTQILRPHIVWFGEMPLEMEKIQTALSECDYFISIGTS
GNVYPAAGFVREALFYGAHTVELNLEPSQVRSSFDECHYGKATELVPHYLAQFL
Download sequence
Identical sequences Q9CM50
WP_010906956.1.12311 WP_010906956.1.15732 WP_010906956.1.19996 WP_010906956.1.21657 WP_010906956.1.40210 WP_010906956.1.45422 WP_010906956.1.4808 WP_010906956.1.51342 WP_010906956.1.53852 WP_010906956.1.6219 WP_010906956.1.62389 WP_010906956.1.66990 WP_010906956.1.81885 WP_010906956.1.8281 WP_010906956.1.89773 WP_010906956.1.9746 WP_010906956.1.9947 272843.PM0993 gi|15602858|ref|NP_245930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]