SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602862|ref|NP_245934.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602862|ref|NP_245934.1|
Domain Number 1 Region: 46-287
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 2.22e-26
Family HlyD-like secretion proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602862|ref|NP_245934.1|
Sequence length 375
Comment hypothetical protein PM0997 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRKYSKYALLVLLLCLVTFYYISEEENSSDIIFPAIRSDIQKVITASGILQAKEEVEIGS
QASGQVKQIVVQEGQRVKKGDLLALIDPRIAETELKLAKAELESAEANLEVKRANLVLSE
VNLARHYQLNKKEATTKKDIEEAENKRIIASAELRMAQSQVESAKVKVEKASTELGYTEI
RSPLDGVVISVVAQSGQTLAASQQTPVLMKLAVIDTMKVNARVSEADVIDLQVGVPVHFT
LLGAPHAQFHAKLAAIKLSPVKVSEATYYYATFEVPNPDHKLRIAMTAEVSILLDKRENV
VTLPISALGQMLKPNHYSVTVLNQSGEKEQVIVKTGLKDGARIEIVEGLSEGDNVVLSVN
PATSLNDEEIYDLGL
Download sequence
Identical sequences Q9CM46
WP_010906958.1.12311 WP_010906958.1.15732 WP_010906958.1.19996 WP_010906958.1.40210 WP_010906958.1.45422 WP_010906958.1.4808 WP_010906958.1.53852 WP_010906958.1.6219 WP_010906958.1.62389 WP_010906958.1.66990 WP_010906958.1.81885 WP_010906958.1.8281 WP_010906958.1.89773 WP_010906958.1.9746 272843.PM0997 gi|15602862|ref|NP_245934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]