SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602866|ref|NP_245938.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602866|ref|NP_245938.1|
Domain Number 1 Region: 129-372
Classification Level Classification E-value
Superfamily Radical SAM enzymes 7.72e-63
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602866|ref|NP_245938.1|
Sequence length 474
Comment (dimethylallyl)adenosine tRNA methylthiotransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTQKLHIKTWGCQMNEYDSSKMADLLNSTHGLELTEIPEEADVLLLNTCSIREKAQEKVF
HQLGRWKELKKHKPGLVIGVGGCVASQEGEHIRTRAPYVDIIFGPQTLHRLPEMINQIRG
GKSSVVDVSFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDD
VLFEIAQLAEQGVREVNLLGQNVNAYRGATHDDGICTFAELLRLVAAIDGIDRLRFTTSH
PIEFTDDIIDVYRDTPELVSFLHLPVQSGSDRVLSMMKRNHTALEYKSIIRKLRAVRPEI
QISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFIYSARPGTPAADMPDDVTEEEKKQ
RLYVLQQRINNQAAQFSRAMLGTEQRVLVEGPSKKDLMELTGRTETNRIVNFVGTPDMIG
KFVDIKITDVFTNSLRGEVVRTEEQMGLRVVQSPQMVINRTRKEDELGVGRYHA
Download sequence
Identical sequences A0A1E3XJ47 Q9L699 V4N8D9
gi|378773845|ref|YP_005176088.1| WP_005717221.1.10027 WP_005717221.1.10721 WP_005717221.1.11014 WP_005717221.1.11214 WP_005717221.1.11947 WP_005717221.1.12156 WP_005717221.1.12311 WP_005717221.1.1307 WP_005717221.1.14908 WP_005717221.1.15732 WP_005717221.1.17217 WP_005717221.1.17980 WP_005717221.1.18123 WP_005717221.1.19996 WP_005717221.1.20287 WP_005717221.1.21657 WP_005717221.1.22153 WP_005717221.1.2313 WP_005717221.1.23830 WP_005717221.1.24757 WP_005717221.1.26616 WP_005717221.1.26777 WP_005717221.1.27416 WP_005717221.1.27592 WP_005717221.1.28084 WP_005717221.1.29697 WP_005717221.1.30617 WP_005717221.1.34253 WP_005717221.1.35562 WP_005717221.1.35978 WP_005717221.1.36022 WP_005717221.1.3807 WP_005717221.1.38246 WP_005717221.1.3839 WP_005717221.1.39152 WP_005717221.1.3957 WP_005717221.1.40210 WP_005717221.1.40787 WP_005717221.1.41351 WP_005717221.1.41462 WP_005717221.1.41657 WP_005717221.1.41667 WP_005717221.1.42469 WP_005717221.1.42512 WP_005717221.1.42943 WP_005717221.1.43687 WP_005717221.1.44741 WP_005717221.1.45422 WP_005717221.1.47685 WP_005717221.1.4808 WP_005717221.1.49053 WP_005717221.1.50853 WP_005717221.1.51342 WP_005717221.1.52066 WP_005717221.1.52585 WP_005717221.1.52859 WP_005717221.1.53852 WP_005717221.1.55074 WP_005717221.1.55401 WP_005717221.1.57420 WP_005717221.1.58111 WP_005717221.1.58257 WP_005717221.1.58450 WP_005717221.1.58628 WP_005717221.1.58910 WP_005717221.1.59455 WP_005717221.1.60664 WP_005717221.1.61098 WP_005717221.1.61860 WP_005717221.1.62016 WP_005717221.1.6219 WP_005717221.1.62389 WP_005717221.1.6332 WP_005717221.1.63549 WP_005717221.1.65482 WP_005717221.1.65878 WP_005717221.1.66934 WP_005717221.1.66990 WP_005717221.1.70689 WP_005717221.1.72215 WP_005717221.1.73917 WP_005717221.1.74955 WP_005717221.1.75804 WP_005717221.1.78987 WP_005717221.1.79347 WP_005717221.1.79593 WP_005717221.1.80223 WP_005717221.1.80589 WP_005717221.1.80911 WP_005717221.1.81885 WP_005717221.1.8281 WP_005717221.1.83579 WP_005717221.1.86541 WP_005717221.1.87897 WP_005717221.1.88402 WP_005717221.1.89773 WP_005717221.1.90081 WP_005717221.1.90179 WP_005717221.1.90578 WP_005717221.1.91495 WP_005717221.1.92478 WP_005717221.1.93940 WP_005717221.1.94432 WP_005717221.1.94435 WP_005717221.1.95718 WP_005717221.1.9746 WP_005717221.1.9947 gi|15602866|ref|NP_245938.1| gi|386833830|ref|YP_006239144.1| 272843.PM1001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]