SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602868|ref|NP_245940.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602868|ref|NP_245940.1|
Domain Number 1 Region: 7-191
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.39e-44
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 300-416
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.16e-27
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 201-292
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.04e-25
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602868|ref|NP_245940.1|
Sequence length 424
Comment hypothetical protein PM1003 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNIEKLKIGIIGLGYVGLPIAVEFGKKVPTVGFDINEKRVKSLASGKDYTLEVSEEELQH
ASKLRYTNQTKGLEECNFFIVTVPTPIDHYKQPDLNPLIKASETIAEVLKKGDVVVYEST
VYPGATEEICVPVLEKMSGLKFNHDFFVGYSPERINPGDKEHRVTNILKITSGSTPLVAN
YIDFVYKLIIKAGTHQAPSIKVAEAAKVIENTQRDVNIALINELALIFNKMGIDTEDVLN
AAGTKWNFLPFKPGLVGGHCIGVDPYYLTHKAQSLGLHPEIILAARRLNDRMGEYVATQL
IKEMVKKDIPVVNSKILVMGLSFKENCPDIRNTKIIDLVNSLKEYDIDIDIYDPWVDKYE
AEAEYGLTPITEIHSHNYDAIIIAVAHQQFKCMTEKDFKALGKENFVLYDLKYVLDQSQA
NIRL
Download sequence
Identical sequences Q9CM41
272843.PM1003 WP_010906963.1.12311 WP_010906963.1.15732 WP_010906963.1.19996 WP_010906963.1.40210 WP_010906963.1.45422 WP_010906963.1.4808 WP_010906963.1.53852 WP_010906963.1.55074 WP_010906963.1.6219 WP_010906963.1.62389 WP_010906963.1.66990 WP_010906963.1.81885 WP_010906963.1.8281 WP_010906963.1.89773 WP_010906963.1.9746 WP_010906963.1.9947 gi|15602868|ref|NP_245940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]