SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602872|ref|NP_245944.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602872|ref|NP_245944.1|
Domain Number 1 Region: 1-260
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.46e-56
Family Tyrosine-dependent oxidoreductases 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602872|ref|NP_245944.1|
Sequence length 344
Comment protein WbjB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFKNKTLLITGGTGSFGNAVLKRFLETDIREIRVFSRDEKKQDDMRKKYNDAKLKFYIGD
VRDYDSILNASRGVDYIYHAAALKQVPSCEFYPLEAVKTNILGTANVLEAAIQNQIKRVV
CLSTDKAVYPINAMGISKAMMEKVIIAKSRNLEGTPTTICCTRYGNVMASRGSVIPLFVD
QIRQGKPFTITDPEMTRFMMTLEDAVDLVLYAFKNGQNGDVFVQKAPAATIGTLAKAITE
LLSVPNHPISIIGTRHGEKAFEALLSREEMVHAINEGNYYRIPADQRSLNYSKYVEKGEP
KITEVTDYNSHNTERLTVKEMKQLLLKLEFIQKMIEGEYISPEV
Download sequence
Identical sequences A0A2J9R1D8 Q9CM37 V4NDV2
272843.PM1007 gi|383309842|ref|YP_005362652.1| WP_005723086.1.11214 WP_005723086.1.11947 WP_005723086.1.12156 WP_005723086.1.14908 WP_005723086.1.17980 WP_005723086.1.19996 WP_005723086.1.23830 WP_005723086.1.24757 WP_005723086.1.26777 WP_005723086.1.27416 WP_005723086.1.27592 WP_005723086.1.28084 WP_005723086.1.35562 WP_005723086.1.36022 WP_005723086.1.3807 WP_005723086.1.38246 WP_005723086.1.3839 WP_005723086.1.3957 WP_005723086.1.40210 WP_005723086.1.40787 WP_005723086.1.41297 WP_005723086.1.41351 WP_005723086.1.41667 WP_005723086.1.43687 WP_005723086.1.49053 WP_005723086.1.52859 WP_005723086.1.55401 WP_005723086.1.57956 WP_005723086.1.58111 WP_005723086.1.58257 WP_005723086.1.60478 WP_005723086.1.61098 WP_005723086.1.6332 WP_005723086.1.63549 WP_005723086.1.66990 WP_005723086.1.70689 WP_005723086.1.72215 WP_005723086.1.75804 WP_005723086.1.78987 WP_005723086.1.79347 WP_005723086.1.79593 WP_005723086.1.8281 WP_005723086.1.88402 WP_005723086.1.89773 WP_005723086.1.92478 WP_005723086.1.93940 WP_005723086.1.95718 WP_005723086.1.9947 gi|15602872|ref|NP_245944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]