SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602880|ref|NP_245952.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602880|ref|NP_245952.1|
Domain Number 1 Region: 283-565
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.75e-50
Family Tyrosine-dependent oxidoreductases 0.0055
Further Details:      
 
Domain Number 2 Region: 117-327
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000233
Family NOL1/NOP2/sun 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602880|ref|NP_245952.1|
Sequence length 648
Comment hypothetical protein PM1015 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNMHYLITSLTLLSKTNKKIFLLVLDFIACPILLWQCYMLRYWSIEISVNLPFLLGISLL
TVGSLLLFGVYDFIIRSFSETLILRLGLATIITVLNLYLVTFIAEEMLPRSIPLMYGFLM
FTWIWLSRGIIRFIVKAHLTTKAPKIRIVVYGAGASGQQIISALQRSCEYLPLFFIDDNK
QLWGRTLGGFKVYSFETAMTLLKDYRVDEILIALPSVSRERRRELIKKLNKTPCKIKELP
SLQQLVDGEVGLSDIQEIAIEDLLGRDPVPPITALLNKNIQHKSVMVTGAGGSIGSELCR
QILLNHPTKLVLFDVSEYALYSIHLELLHIQQEKGTHVEIIPLLGSVQNLKLLIKVMQTF
EVNTVYHAAAYKHVPLVEYNVIQAVYNNIFGTYNAAKAAMRCQVDAFVLISTDKAVRPTN
VMGTTKRVAELCLQACADTYGKTLDGVVHKTLFCMVRFGNVLGSSGSVIPLFKQQIKEGG
PITVTDERIIRYFMTIPEAAQLVIQAGAMAKGGDVFILDMGEPVKILELAKKLILLSGLS
IKNENNPNGDIEIKFTGLRPGEKLYEELLIGGENVRKTLHPRILTAQETCLPFSELSLLL
DELERACKKSDYQKIHDILRNAPTGYQPVTELADLIYTQQNNHIHLWG
Download sequence
Identical sequences A0A2J7XWM5 Q9CM29
gi|15602880|ref|NP_245952.1| 272843.PM1015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]