SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602882|ref|NP_245954.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602882|ref|NP_245954.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Phosphotyrosine protein phosphatases I 1.44e-37
Family Low-molecular-weight phosphotyrosine protein phosphatases 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602882|ref|NP_245954.1|
Sequence length 147
Comment hypothetical protein PM1017 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFEQILVVCMGNICRSPVGEKLLQHHFPEKNITSAGLVTERSRLVDKPADDMMIKIASQH
GLNLSAHRAKQLTHALCHKADLILVMEKAHIELVHQICPLSQGKVMLFGHGLTASKEIPD
PYKKSQEMFEYAYQMLDSAAYQWKKML
Download sequence
Identical sequences Q9CM27
WP_005754506.1.12311 WP_005754506.1.14908 WP_005754506.1.15732 WP_005754506.1.19996 WP_005754506.1.3957 WP_005754506.1.40210 WP_005754506.1.45422 WP_005754506.1.4808 WP_005754506.1.53852 WP_005754506.1.61098 WP_005754506.1.6219 WP_005754506.1.62389 WP_005754506.1.66990 WP_005754506.1.81885 WP_005754506.1.8281 WP_005754506.1.89773 WP_005754506.1.9746 WP_005754506.1.9947 272843.PM1017 gi|15602882|ref|NP_245954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]