SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602889|ref|NP_245961.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602889|ref|NP_245961.1|
Domain Number 1 Region: 233-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-98
Family Hsp90 middle domain 0.000000696
Further Details:      
 
Domain Number 2 Region: 5-216
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-66
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000607
Further Details:      
 
Domain Number 3 Region: 514-625
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 7.72e-35
Family HSP90 C-terminal domain 0.00000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602889|ref|NP_245961.1|
Sequence length 631
Comment heat shock protein 90 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSTNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFKALSVPELYEG
DGDLKVRIRFDEEKGTLTISDNGIGMTRDEVIDHLGTIAKSGTKEFLSALGQDQAKDSQL
IGQFGVGFYSAFIVADKVTVKTRAAGVSADKAVLWESAGEGEYSVADIDKKERGTEITLH
LREDEKAFLNDWRLREIIGKYSDHIGLPVEILAKEYDDEGKETGIKWEKINKAQALWTRA
KNEISEEEYQEFYKHLSHDFTDPLLWAHNKVEGNQEYTSLLYVPAKAPWDLFNREHKHGL
KLYVQRVFIMDDAQVFMPNYLRFMRGLLDSNDLPLNVSREILQDNKVTSALRKALTKRAL
QMLEKLAKDDAEKYQRFWQEFGLVLKEGPAEDFANKETIAKLLRFASTHNDSSQQSVSLE
DYVARMKEGQKAIYYITADTYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDG
KPLQTISKADLDLGDLADKEEDSQKAQDEQYASFVERVKTLLGERVKEVRLTHRLTDTPA
VVSTGDDQMTTQMAKLFAAAGQAMPEVKYTFELNPEHGLVQKVAEIADEQQFADWIELLL
EQAMLAERGSLENPVAFIKRMNTLLSKLTSH
Download sequence
Identical sequences Q9CM20
WP_010906976.1.12311 WP_010906976.1.15732 WP_010906976.1.19996 WP_010906976.1.40210 WP_010906976.1.45422 WP_010906976.1.4808 WP_010906976.1.53852 WP_010906976.1.6219 WP_010906976.1.62389 WP_010906976.1.66990 WP_010906976.1.81885 WP_010906976.1.8281 WP_010906976.1.89773 WP_010906976.1.9746 WP_010906976.1.9947 272843.PM1024 gi|15602889|ref|NP_245961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]