SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602895|ref|NP_245967.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602895|ref|NP_245967.1|
Domain Number 1 Region: 1-342
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.53e-89
Family Tyrosine-dependent oxidoreductases 0.00000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602895|ref|NP_245967.1|
Sequence length 345
Comment protein RffG [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKILITGGAGFIGSAVIRYILSQTSDQIINLDKLTYASNLDALATVVDNPRYHFEQGDI
ADATTLSNIFQRYQPDCVMHLAAESHVDRSIAGAAAFIQTNIVGTYTLLEVARQYWLTLD
EKSKAAFRFHHVSTDEVFGDLDFTQPAFTETSPYRPSSPYSASKAASDHLVRAWHRTYGL
PIVMSNSTNNYGFYQHTEKLIPFMLSQALQGKPLTLYGDGQQVRDWLFVDDHAQALYLVL
TKGKVGETYNIGARCEYSNIHLVMRLCEILNQLRQAGGLTAFSDQLSEITDFKQLITFVK
DRPGHDLRYAINASKIQDELGWVAKTDFETGLRKTVAWYVDYLSP
Download sequence
Identical sequences Q9CM15
WP_010906979.1.12311 WP_010906979.1.15732 WP_010906979.1.40210 WP_010906979.1.45422 WP_010906979.1.4808 WP_010906979.1.53852 WP_010906979.1.6219 WP_010906979.1.62389 WP_010906979.1.66990 WP_010906979.1.81885 WP_010906979.1.8281 WP_010906979.1.89773 WP_010906979.1.9746 WP_010906979.1.9947 gi|15602895|ref|NP_245967.1| 272843.PM1030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]