SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602899|ref|NP_245971.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602899|ref|NP_245971.1|
Domain Number 1 Region: 3-342
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.33e-106
Family Aldose 1-epimerase (mutarotase) 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602899|ref|NP_245971.1|
Sequence length 343
Comment aldose 1-epimerase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLSKCTLGVAPDGQPFQLVTLSNAKGMSIQVMDWGATWLSCKVPVQNQLREVLLGCQLED
YPKQQVYLGATIGRYANRIANGRFVLNGVPIQLQTNQGQHQLHGGENGFDCQRWQLEKCG
ENFVCFSLSSPDGDQGFPGHVKVCVTYLLNEQNCVEIQFEAESDQDTPLNLTNHAYFNLN
NAELGEDIREHYLQVNADHYLPVNPEGIPCAALKSVQGTSFDFREMKSIEKDFLQDEQAL
VKGYDHAFLLNQDKEKLSAVLTAADGSLRLQVSTSQPALQIYTGNFLAGTPNRFGSYYQD
YVGIALETQALPDTPNHPEWWTLGGMSQAGEKYQHWTRFNFSS
Download sequence
Identical sequences Q9CM12
gi|15602899|ref|NP_245971.1| 272843.PM1034 WP_010906981.1.12311 WP_010906981.1.15732 WP_010906981.1.19996 WP_010906981.1.40210 WP_010906981.1.4808 WP_010906981.1.53852 WP_010906981.1.6219 WP_010906981.1.62389 WP_010906981.1.66990 WP_010906981.1.81885 WP_010906981.1.8281 WP_010906981.1.89773 WP_010906981.1.9746 WP_010906981.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]