SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602901|ref|NP_245973.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602901|ref|NP_245973.1|
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily HIT-like 7.29e-74
Family Hexose-1-phosphate uridylyltransferase 0.000000263
Further Details:      
 
Domain Number 2 Region: 181-346
Classification Level Classification E-value
Superfamily HIT-like 1.55e-56
Family Hexose-1-phosphate uridylyltransferase 0.000000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602901|ref|NP_245973.1|
Sequence length 348
Comment galactose-1-phosphate uridylyltransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRHSRFEPTEHPHRRYNPLTDQWVLVSPHRAKRPWQGQQEKVAEDEKPSYDPTCYLCPSN
KRITGEQNPDYQKPFVFKNDFSALLEETPNPEKSTDPLFQISKAQGESRVICFSPDHSKT
LPLLTVEEIHDVIKVWQEQLLELGQKYQWVQIFENKGAAMGCSNPHPHGQIWANSFLPNE
VARADQTQRAYLAKQGSVMLMDYAKREIELKERVVVETEHWLAVVPYWAVWPFETLLMPK
AHVKRLTDLTEEQSKDLALALKKLTTKYDNLFETSFPYSMGFHAAPFNEESNEHWQLHAH
FYPPLLRSATVRKFMVGYEMLGESQRDLTAEQAAERLRVLSEVHYKQR
Download sequence
Identical sequences A0A1D7R3I7 Q9CM11 V4MNU3
WP_005754530.1.10027 WP_005754530.1.10721 WP_005754530.1.12311 WP_005754530.1.1307 WP_005754530.1.14908 WP_005754530.1.15732 WP_005754530.1.17217 WP_005754530.1.18123 WP_005754530.1.19996 WP_005754530.1.20287 WP_005754530.1.22153 WP_005754530.1.2313 WP_005754530.1.23830 WP_005754530.1.26616 WP_005754530.1.26777 WP_005754530.1.27416 WP_005754530.1.29697 WP_005754530.1.30617 WP_005754530.1.34253 WP_005754530.1.35978 WP_005754530.1.39152 WP_005754530.1.3957 WP_005754530.1.40210 WP_005754530.1.41462 WP_005754530.1.4211 WP_005754530.1.42943 WP_005754530.1.44741 WP_005754530.1.45422 WP_005754530.1.47685 WP_005754530.1.4808 WP_005754530.1.50853 WP_005754530.1.52066 WP_005754530.1.53852 WP_005754530.1.57420 WP_005754530.1.58450 WP_005754530.1.58628 WP_005754530.1.58910 WP_005754530.1.59455 WP_005754530.1.60664 WP_005754530.1.61098 WP_005754530.1.61860 WP_005754530.1.62016 WP_005754530.1.6219 WP_005754530.1.62389 WP_005754530.1.65482 WP_005754530.1.65878 WP_005754530.1.66934 WP_005754530.1.66990 WP_005754530.1.73917 WP_005754530.1.74955 WP_005754530.1.75804 WP_005754530.1.80223 WP_005754530.1.80589 WP_005754530.1.80911 WP_005754530.1.81885 WP_005754530.1.8281 WP_005754530.1.86541 WP_005754530.1.87897 WP_005754530.1.89773 WP_005754530.1.90081 WP_005754530.1.90179 WP_005754530.1.91495 WP_005754530.1.94435 WP_005754530.1.9746 WP_005754530.1.9947 gi|15602901|ref|NP_245973.1| 272843.PM1036 gi|378773810|ref|YP_005176053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]