SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602902|ref|NP_245974.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602902|ref|NP_245974.1|
Domain Number 1 Region: 61-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.11e-81
Family L-arabinose binding protein-like 0.0000403
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.41e-18
Family GalR/LacI-like bacterial regulator 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602902|ref|NP_245974.1|
Sequence length 334
Comment GalR protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVTIHDVAQHAGVSVATVSRVLNNHPSASEKARIAVQAAIEKLGYQPNANAQALAMKNTD
TIGVVVTDVTDAFFAILVKAVDKVAEEYKKTIIIGIGYHNAEKEKEAIDTLLRKRCSCLV
VHAKALSDEVLCQYLEKVPGMVIINRVVQGYEHRCVSLDNEKGTFIATETLIKLGHKKIG
YIGSNHYIMDEIERHRGYLAALKQYHIPVIEHAITHSSPDFEGGEEAMINLLSYNSDLTA
VVAYNDSMAAGAISVLNENNIRVPAQCSIIGFDDMPIARYLIPKLTTIRYPIDLMANYAA
KLALSLVDQDVKKPSHIQFNPTLVRRFSTEQHSQ
Download sequence
Identical sequences A0A1D2NWV4 Q9CM10
272843.PM1037 WP_005723165.1.11014 WP_005723165.1.11214 WP_005723165.1.11947 WP_005723165.1.12156 WP_005723165.1.14908 WP_005723165.1.17980 WP_005723165.1.19996 WP_005723165.1.24757 WP_005723165.1.26777 WP_005723165.1.28084 WP_005723165.1.35562 WP_005723165.1.36022 WP_005723165.1.3807 WP_005723165.1.38246 WP_005723165.1.3839 WP_005723165.1.3957 WP_005723165.1.40787 WP_005723165.1.41351 WP_005723165.1.41667 WP_005723165.1.4211 WP_005723165.1.42469 WP_005723165.1.43687 WP_005723165.1.52585 WP_005723165.1.52859 WP_005723165.1.55074 WP_005723165.1.55401 WP_005723165.1.58111 WP_005723165.1.58257 WP_005723165.1.60478 WP_005723165.1.61098 WP_005723165.1.62389 WP_005723165.1.6332 WP_005723165.1.63549 WP_005723165.1.66990 WP_005723165.1.70689 WP_005723165.1.72215 WP_005723165.1.78987 WP_005723165.1.79347 WP_005723165.1.81885 WP_005723165.1.83579 WP_005723165.1.88402 WP_005723165.1.90578 WP_005723165.1.92478 WP_005723165.1.93940 WP_005723165.1.95718 WP_005723165.1.9947 gi|15602902|ref|NP_245974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]