SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602903|ref|NP_245975.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602903|ref|NP_245975.1|
Domain Number 1 Region: 27-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-79
Family L-arabinose binding protein-like 0.00000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602903|ref|NP_245975.1|
Sequence length 330
Comment protein MglB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKTVLSAVALAVGLGVAASAAQAADRIGVTIYKYDDNFMSLMRKEINKEAEQFKDIELL
MNDSQNAQAVQNDQVDGLISKGVKALAINLVDPAAAPTIIGKAKPDDIPVVFFNKDPGAK
AIGSYEHAYYVGTDPKESGLIQGSLIAKHWQANPAYDLNKDGKIQYVLLKGEPGHPDAEA
RTKFVIEELNNKGIQTEQLFIDTGMWDAALAKDKMDAWLSSSKANQIEVIIANNDGMAMG
ALEATKAHGKKLPIFGVDALPEVLQLIKKGEIAGTVLNDGVNQGKAVVQLSNNLAKGKPA
TEGTKWQLKDRVVRIPYVGVDADNLNEFLK
Download sequence
Identical sequences A0A1D2NWS6 Q9CM09
gi|383309810|ref|YP_005362620.1| gi|15602903|ref|NP_245975.1| gi|386833792|ref|YP_006239106.1| WP_005751770.1.11214 WP_005751770.1.11947 WP_005751770.1.12156 WP_005751770.1.12311 WP_005751770.1.15732 WP_005751770.1.17980 WP_005751770.1.19996 WP_005751770.1.21657 WP_005751770.1.24757 WP_005751770.1.26777 WP_005751770.1.27592 WP_005751770.1.28084 WP_005751770.1.35562 WP_005751770.1.36022 WP_005751770.1.3807 WP_005751770.1.38246 WP_005751770.1.40210 WP_005751770.1.40787 WP_005751770.1.41297 WP_005751770.1.41351 WP_005751770.1.41657 WP_005751770.1.41667 WP_005751770.1.4211 WP_005751770.1.42512 WP_005751770.1.43687 WP_005751770.1.45422 WP_005751770.1.4808 WP_005751770.1.49053 WP_005751770.1.51342 WP_005751770.1.52585 WP_005751770.1.52859 WP_005751770.1.53852 WP_005751770.1.55401 WP_005751770.1.57956 WP_005751770.1.58111 WP_005751770.1.58257 WP_005751770.1.60478 WP_005751770.1.6219 WP_005751770.1.62389 WP_005751770.1.6332 WP_005751770.1.63549 WP_005751770.1.66990 WP_005751770.1.72215 WP_005751770.1.75804 WP_005751770.1.78987 WP_005751770.1.79347 WP_005751770.1.81885 WP_005751770.1.8281 WP_005751770.1.83579 WP_005751770.1.88402 WP_005751770.1.89773 WP_005751770.1.92478 WP_005751770.1.93940 WP_005751770.1.94432 WP_005751770.1.95718 WP_005751770.1.9746 272843.PM1038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]