SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602913|ref|NP_245985.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602913|ref|NP_245985.1|
Domain Number 1 Region: 3-459
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.32e-137
Family Glutamate-cysteine ligase 0.0000173
Further Details:      
 
Domain Number 2 Region: 489-623,659-755
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.46e-27
Family SCOPe 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602913|ref|NP_245985.1|
Sequence length 757
Comment bifunctional glutamate--cysteine ligase/glutathione synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKIQHIIHENQLGLLFQQGSFGLEKESQRVTADGAIVTTPHPAVFGNRRYHPYIQTDFAE
SQLELITPPTKKLEDTFRWLSVIHEVVQRSLPEEEYIFPLSMPAGLPAEEQIRVAQLDNP
EDVAYREYLVKIYGKNKQMVSGIHYNFQLSPDLITRLFRLQNEYQSAVDFQNDLYLKMAK
NFLRYQWILLYLLAATPTVESAYFKDGSPLAKGQFVRSLRSSQYGYVNDPEINVSFDSVE
KYVESLEHWVSTGKLIAEKEFYSNVRLRGAKKAREFLTTGIQYLEFRLFDLNPFEIYGIS
LKDAKFIHVFALFMIWMDHTADQEEVELGKARLAEVAFEHPLEKTAYAVEGELVLLELLS
MLEQIGAEPELFEIVKEKLTQFTDPSKTVAGRLVRAIEQAGSDQQLGAQLAQQYKAQAFE
RFYALSAFDNMELSTQALLFDVIQKGIHTEILDENDQFLCLKYGDHIEYVKNGNMTSHDS
YISPLIMENKVVTKKVLQKAGFNVPQSVEFTSLEKAVASYALFENRAVVIKPKSTNYGLG
ITIFQQGVQNREDFAKALEIAFREDKEVMVEDYLVGTEYRFFVLGDETLAVLLRVPANVV
GDSVHSVAELVAMKNDHPLRGDGSRTPLKKIALGEIEQLQLKEQGLTIDSIPAKDQLVQL
RANSNISTGGDSIDMTDEMHESYKQLAVGITKAMGAAVCGVDLIIPDLKQPATPNLTSWG
VIEANFNPMMMMHIFPYAGKSRRLTQNVIKMLFPELE
Download sequence
Identical sequences Q9CM00
3ln7_A 3ln7_B 272843.PM1048 gi|15602913|ref|NP_245985.1| WP_010906990.1.12311 WP_010906990.1.15732 WP_010906990.1.19996 WP_010906990.1.40210 WP_010906990.1.45422 WP_010906990.1.4808 WP_010906990.1.53852 WP_010906990.1.6219 WP_010906990.1.62389 WP_010906990.1.66990 WP_010906990.1.8281 WP_010906990.1.89773 WP_010906990.1.9746 WP_010906990.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]