SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602928|ref|NP_246000.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602928|ref|NP_246000.1|
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily MtlR-like 8.89e-56
Family MtlR-like 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602928|ref|NP_246000.1|
Sequence length 172
Comment mannitol repressor protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQSVDPIYEKLNEATSIRGFITASVAIFDEAVDKLINRVFRKTDFAVKSVVDSLLSNSGP
LCDLSIRLKVLLGLGIIEHHVFSDISHFIEIKEKLNNDEKEYDFADLIIIDFIQQLSCQN
DKSLLNFPMEKDENPDSLLYQVKALRREKLIRSYLTLAITEIYEQLQIESPL
Download sequence
Identical sequences Q9CLY6
WP_010906997.1.12311 WP_010906997.1.15732 WP_010906997.1.19996 WP_010906997.1.62389 WP_010906997.1.66990 WP_010906997.1.81885 WP_010906997.1.9947 272843.PM1063 gi|15602928|ref|NP_246000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]