SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602930|ref|NP_246002.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602930|ref|NP_246002.1|
Domain Number 1 Region: 525-930
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.02e-155
Family DNA polymerase I 0.0000000000653
Further Details:      
 
Domain Number 2 Region: 331-519
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-55
Family DnaQ-like 3'-5' exonuclease 0.00000105
Further Details:      
 
Domain Number 3 Region: 7-170
Classification Level Classification E-value
Superfamily PIN domain-like 2.94e-55
Family 5' to 3' exonuclease catalytic domain 0.0000544
Further Details:      
 
Domain Number 4 Region: 171-290
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 5.53e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602930|ref|NP_246002.1|
Sequence length 930
Comment DNA polymerase I [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAKIAENPLVLVDGSSYLYRAFHAFPPLTNSLNEPTGAMYGVLNMLKSLISQVQPSHIAV
VFDAKGKTFRDEIFEQYKSHRPPMPEELRSQILPLHNIIRALGIPLLVVEGVEADDVIGT
LAVQASRAGKKVLISTGDKDMAQLVDENIMLINTMTNTLLDREGVLEKYGLPPELIIDYL
ALMGDSSDNIPGIPGVGEKTALGLLQGIGSMAEIYANLDKVASLSLRGAKTLGAKLAEAK
DLADLSYLLATIKTDVALDVSPEQLTFGVANKDALIEYFARYEFKRWLNEVMNGGESSVT
NGSEQAVKINPYQATPSTNERENTVSVQIDRSQYQCLLELSELKRWIDKLNQAKCIAIDT
ETDSLDYMVAHLVGVSFALENGEAAYLPLRHDYLGAPQQVDFQTALSLLKPVLENPEIHK
VGQNIKYDLSIFARHGIEVQGVSYDTMLLSYVLDSTGRHNMDELAKRYLGHQTIHFEDIA
GKGKAQLTFNQIPLEQAAEYAAEDADITMKLQQVLWEKVAAQPELVKLYQTMELPLASVL
SRIERHGVLIDSDALFSQSQQIGVRLTALEQQAYELAGQQFNLASTKQLQEILFDKLSLP
VLKKTPKGAPSTNEEVLEELAYEHALPKILVEHRGLSKLKSTYTDKLPLMVNKDTGRVHT
SYHQAVTATGRLSSSDPNLQNIPIRNEEGRRIRQAFIAPEGYQIMAADYSQIELRIMAHL
SQDKGLINAFNEGKDIHRSTAAEIFGIPLAQVSSEQRRSAKAINFGLIYGMSSFGLSRQL
GIPRHEAQKYMDLYFQRYPGVQAFMHDIRETAKAQGYVTTLFDRRLYLPDIQSSNAIRRK
AAERVAINAPMQGTAADIIKRAMITLDREIAGQPDIKMIMQVHDELVFEVRTDKIEHFRT
IIKTTMEQAAQLVVPLIVDVGVGKNWDEAH
Download sequence
Identical sequences Q9CLY4
272843.PM1065 WP_010906999.1.12311 WP_010906999.1.15732 WP_010906999.1.19996 WP_010906999.1.62389 WP_010906999.1.66990 WP_010906999.1.81885 WP_010906999.1.9947 gi|15602930|ref|NP_246002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]