SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602939|ref|NP_246011.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602939|ref|NP_246011.1|
Domain Number 1 Region: 41-232
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.26e-39
Family Phosphoglucomutase, first 3 domains 0.0008
Further Details:      
 
Domain Number 2 Region: 301-439
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.02e-26
Family Phosphoglucomutase, first 3 domains 0.0024
Further Details:      
 
Domain Number 3 Region: 209-312
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.96e-22
Family Phosphoglucomutase, first 3 domains 0.0049
Further Details:      
 
Domain Number 4 Region: 424-550
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.35e-22
Family Phosphoglucomutase, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602939|ref|NP_246011.1|
Sequence length 551
Comment hypothetical protein PM1074 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSIFTLAQHWLAQDPDPETHAELTALLDAAKTGDAKASTELNARFDGRLQFGTAGLRGRL
QAGPMGMNRVLVAQAAGGLADYLKDYDKTPSIVIGYDGRKNSDVFARDTAEIMAGAGIKA
YLLPRKLPTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVYLGKANGGGQIVSPADQDI
AKLIDKVAAGSIKDLPRSQDFIVLDDEVVDAYIAKTASLAKEPQTDINYVYTAMHGVGYE
VLSKTLAKAGLPQPHLVAEQVWPDGTFPTVNFPNPEEKGALDLAIKVAKEKNAEFIIAND
PDADRLAVAVPDAEGNWKPLHGNVVGCFLGWYLAKQYHAQGQKGILACSLVSSPALAEIA
KKYGFQSEETLTGFKYIGKVDGLLFGFEEALGYLVDPDKVRDKDGISAAISFLDLVRYLK
KQGKTLADYADEFTQEFGAYVSGQISIRVDDLSEIGKLMSALRQNPPSDIGGFKVAQFLD
HTKTDRQSDILVFVLENGSRLIVRPSGTEPKIKFYLDAKGKDPKDAEQVLAQFDESVRHI
LRQDEFGKQDC
Download sequence
Identical sequences A0A1D7R3M9 Q9CLX5 V4PVW2
gi|378773771|ref|YP_005176014.1| gi|383309772|ref|YP_005362582.1| 272843.PM1074 gi|15602939|ref|NP_246011.1| WP_010907004.1.10027 WP_010907004.1.10721 WP_010907004.1.12311 WP_010907004.1.1307 WP_010907004.1.15732 WP_010907004.1.17217 WP_010907004.1.18123 WP_010907004.1.19996 WP_010907004.1.20287 WP_010907004.1.21657 WP_010907004.1.22153 WP_010907004.1.2313 WP_010907004.1.23830 WP_010907004.1.26616 WP_010907004.1.27416 WP_010907004.1.29697 WP_010907004.1.30617 WP_010907004.1.34253 WP_010907004.1.35978 WP_010907004.1.39152 WP_010907004.1.40210 WP_010907004.1.41297 WP_010907004.1.41462 WP_010907004.1.42943 WP_010907004.1.44741 WP_010907004.1.45422 WP_010907004.1.47685 WP_010907004.1.4808 WP_010907004.1.50853 WP_010907004.1.51342 WP_010907004.1.52066 WP_010907004.1.53852 WP_010907004.1.55074 WP_010907004.1.57420 WP_010907004.1.57956 WP_010907004.1.58450 WP_010907004.1.58628 WP_010907004.1.58910 WP_010907004.1.59455 WP_010907004.1.60664 WP_010907004.1.61860 WP_010907004.1.62016 WP_010907004.1.6219 WP_010907004.1.62389 WP_010907004.1.65482 WP_010907004.1.65878 WP_010907004.1.66934 WP_010907004.1.66990 WP_010907004.1.73917 WP_010907004.1.74955 WP_010907004.1.75804 WP_010907004.1.80223 WP_010907004.1.80589 WP_010907004.1.80911 WP_010907004.1.81885 WP_010907004.1.8281 WP_010907004.1.86541 WP_010907004.1.87897 WP_010907004.1.89773 WP_010907004.1.90081 WP_010907004.1.90179 WP_010907004.1.91495 WP_010907004.1.94435 WP_010907004.1.9746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]