SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602950|ref|NP_246022.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602950|ref|NP_246022.1|
Domain Number 1 Region: 1037-1293
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.2e-94
Family Class I glutamine amidotransferases (GAT) 0.0000000114
Further Details:      
 
Domain Number 2 Region: 620-816
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 3.4e-69
Family PurM N-terminal domain-like 0.0000000322
Further Details:      
 
Domain Number 3 Region: 222-428
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.75e-63
Family PurM N-terminal domain-like 0.00000000922
Further Details:      
 
Domain Number 4 Region: 432-615
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 6.73e-54
Family PurM C-terminal domain-like 0.0000000219
Further Details:      
 
Domain Number 5 Region: 825-1035
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 7.33e-54
Family PurM C-terminal domain-like 0.000000261
Further Details:      
 
Domain Number 6 Region: 2-152
Classification Level Classification E-value
Superfamily PurS-like 5.75e-49
Family FGAM synthase PurL, PurS-like domain 0.00000422
Further Details:      
 
Domain Number 7 Region: 156-221
Classification Level Classification E-value
Superfamily FGAM synthase PurL, linker domain 3.4e-22
Family FGAM synthase PurL, linker domain 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602950|ref|NP_246022.1|
Sequence length 1297
Comment phosphoribosylformylglycinamidine synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLQIFRGSPALSEFRLNQLAVRFQKANLPVSACYAEYIHFADLSDRLTEEETAKLDQLLH
YGPTLAGHDPVGHCFIVIPRIGTISSWSSKATDIAHNCGLNKVNRLERGLAFYFEFDRTL
SSEEQQRLVSHIHDRMLEGIIHTPEEAKVLFDQQAPKPFTTVDILSGGRQALENANVELG
LALAEDEIDYLVENFTALGRNPNDIELYMFAQANSEHCRHKIFNADWIIDGEKQEKSLFK
MIKNTFEKTPDHVLSAYKDNAAVMEGSKVGRFFPDQDGQYRYHNEDAHILMKVETHNHPT
AISPFPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNLVIPGFEQPWENPVSKPNRIA
SALDIMIEGPLGGAAFNNEFGRPALLGYFRTYEEKVNSFAGEEVRGYHKPIMLAGGIGNI
RAEHVQKGEIPVGAKLIVLGGPAMNIGLGGGAASSMASGKSKEDLDFASVQRDNPEMERR
CQEVIDRCWQLGEDNPILFIHDVGAGGLSNAMPELVHDGGRGGKFELRKILSDERGMSPL
EIWCNESQERYVLAVAPEKLELFTALCERERAPFAVIGEATEQEHLTLHDDHFDNNPIDL
PMNVLLGKTPKMTRDVKSKTVEGSALDHSQIDLKEAFHRVLRLPVVAEKTFLITIGDRSV
TGMVARDQMVGPWQIPVADCAVTTASLDSYHGEAMSMGERAPVALLDFAASARLAVAESI
TNIAATNIGDIKRIKLSANWMSAAGHEGEDAGLYQAVKAVGEELCPQLGLTIPVGKDSMS
MKTTWHENGEQKTVTAPLSLVISAFARVEDVRKTVTPQLRTDKGHSRLLLIDLGEGKNRL
GATALAQVYKQLGDKPADVVNVESLKNFFNAMQALVAEQKLLAYHDRSDGGLIATLAEMA
FAGNCGLSIHISALGDNDLAVLFNEELGAVIQVRESDLSYVRDVLSQHGLIHLTKELGEV
TTEDRIEISRGTKLLFSQKRSELRGIWAELTHQMQRLRDNPECADQEFAAKKDPENKGFS
AHLTYDINEDIAAPYIATGKKPRIAILREQGVNSHYEMAAAFDRAGFEAIDVHMSDLHNA
RYRLKDFNALVACGGFSYGDVLGAGGGWAKSILFNPMLRDQFSEFFANPNTLTLGVCNGC
QMVSNLAEIIPGTDAWPRFVRNKSERFEARAALVRINETNSLWFQGMAGSHMPIAVSHGE
GRVEFKHDQQLQMLKDQNLIVAQYIDNNLNPTEIYPANPNGSVEGITALSNQDGRVAIMM
PHPERVFRTVSNSWHPEDWSEDGAWMRLFRNARVVLE
Download sequence
Identical sequences Q9CLW4
272843.PM1085 gi|15602950|ref|NP_246022.1| WP_010907012.1.66990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]