SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602959|ref|NP_246031.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602959|ref|NP_246031.1|
Domain Number 1 Region: 111-326
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-51
Family D-glucarate dehydratase-like 0.000000307
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.05e-28
Family Enolase N-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602959|ref|NP_246031.1|
Sequence length 337
Comment O-succinylbenzoate synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTMIRKFKLYQYSIPVDSQLILRNRFLKKREGLLVQVCCDDAQGWGEIAPLPEFSQETLE
QAREQALAWLEEWSASDGSAGKLPLEHLFPSVAFGLSCALAEMKGLLHEEGNYQVAPLCY
GDPDELYDPLNQMQGEKVAKIKVGMYEANRDGLIADMLLEAIPDLHLRLDANRSWTPSKA
QMFAKYVKPEHRARIQFLEEPCKTPAESLQFAEETGIAIAWDETVRDAEFQQNPPHFFTP
QVKAIVIKPTLVGSIQRCVELIKQAHAHGIQAVISSSIESSLGLTQLARLAQQYTPNTVP
GLDTLDLMDYQVIRPWPSSTLPLIDLDSEYIVPIKLD
Download sequence
Identical sequences Q9CLV7
gi|15602959|ref|NP_246031.1| WP_010907015.1.11014 WP_010907015.1.12311 WP_010907015.1.15732 WP_010907015.1.19996 WP_010907015.1.40210 WP_010907015.1.42469 WP_010907015.1.45422 WP_010907015.1.4808 WP_010907015.1.53852 WP_010907015.1.6219 WP_010907015.1.62389 WP_010907015.1.66990 WP_010907015.1.81885 WP_010907015.1.89773 WP_010907015.1.90578 WP_010907015.1.9746 WP_010907015.1.9947 272843.PM1094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]