SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602973|ref|NP_246045.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602973|ref|NP_246045.1|
Domain Number 1 Region: 21-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.34e-40
Family Phosphate binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602973|ref|NP_246045.1|
Sequence length 245
Comment ModB protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLIVLSTLITATFSAQAAELYLYAGAGLKDPVEKIVKQFEKETGNNVTIEYGGSGQLL
ARYNTVKTGDLYLPGSSDYVEKLEKTGDVKESAPLVLHIPVMAIRKEKSAGIDSFKALAE
SNLRLGIGDSKAMALGKGAEKILELSGYQAQLNDKIVVKAATVKQLMLYLLNGDVDAAVV
GRSGAWKVRDKVDLLPNPAGTPEEKVTIALLASTKHPKEAKQLLDLFNSEQGVKYFVDEG
FLPIK
Download sequence
Identical sequences A0A1E3XLX1 Q9CLU7
WP_005723309.1.11014 WP_005723309.1.11214 WP_005723309.1.11947 WP_005723309.1.12156 WP_005723309.1.12311 WP_005723309.1.15732 WP_005723309.1.17980 WP_005723309.1.19996 WP_005723309.1.21657 WP_005723309.1.24757 WP_005723309.1.26777 WP_005723309.1.27416 WP_005723309.1.27592 WP_005723309.1.28084 WP_005723309.1.35562 WP_005723309.1.36022 WP_005723309.1.3807 WP_005723309.1.38246 WP_005723309.1.3839 WP_005723309.1.40210 WP_005723309.1.40787 WP_005723309.1.41297 WP_005723309.1.41351 WP_005723309.1.41657 WP_005723309.1.41667 WP_005723309.1.4211 WP_005723309.1.42469 WP_005723309.1.43687 WP_005723309.1.45422 WP_005723309.1.4808 WP_005723309.1.49053 WP_005723309.1.51342 WP_005723309.1.52585 WP_005723309.1.52859 WP_005723309.1.53852 WP_005723309.1.55401 WP_005723309.1.57956 WP_005723309.1.58111 WP_005723309.1.58257 WP_005723309.1.60478 WP_005723309.1.6219 WP_005723309.1.62389 WP_005723309.1.6332 WP_005723309.1.63549 WP_005723309.1.66990 WP_005723309.1.70689 WP_005723309.1.72215 WP_005723309.1.75804 WP_005723309.1.78987 WP_005723309.1.79347 WP_005723309.1.79593 WP_005723309.1.81885 WP_005723309.1.8281 WP_005723309.1.83579 WP_005723309.1.88402 WP_005723309.1.89773 WP_005723309.1.90578 WP_005723309.1.92478 WP_005723309.1.93940 WP_005723309.1.94432 WP_005723309.1.95718 WP_005723309.1.9746 WP_005723309.1.9947 gi|15602973|ref|NP_246045.1| gi|386833720|ref|YP_006239034.1| 272843.PM1108 gi|383309741|ref|YP_005362551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]