SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602979|ref|NP_246051.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602979|ref|NP_246051.1|
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-50
Family Ribonuclease PH domain 1-like 0.0000128
Further Details:      
 
Domain Number 2 Region: 294-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-45
Family Ribonuclease PH domain 1-like 0.0000135
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.02e-30
Family Ribonuclease PH domain 2-like 0.00093
Further Details:      
 
Domain Number 4 Region: 452-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-27
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0044
Further Details:      
 
Domain Number 6 Region: 622-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.15e-21
Family Cold shock DNA-binding domain-like 0.0000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602979|ref|NP_246051.1|
Sequence length 714
Comment polynucleotide phosphorylase/polyadenylase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVAKKDVKEGQDFFPLTV
NYQERTYAAGRIPGGFFKREGRPSEGETLIARLIDRPIRPLFPEGFYNEIQIVATVVSVN
PQICPDLVAMIGASAALSLSGVPFNGPIGAARVGFIDDQFVLNPTMNEQKQSRLDLVVAG
TDKAVLMVESEADVLTEEQMLAAVVFGHQQQQVVIDAIKEFTAEAGKPRWDWVAPEPNTA
LIEKVKAIAEARLGEAYRITEKQARYEQIDAIKADVIAQITAEVAEGEDISEGKIVDIFT
ALESQIVRSRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGT
ERDAQIIDELTGERSDHFLFHYNFPPYSVGETGMIGSPKRREIGHGRLAKRGVAAVMPTL
AEFPYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEDEKFVVL
SDILGDEDHLGDMDFKVAGTRTGVTALQMDIKIEGITAEIMQIALNQAKSARLHILGVME
QAIPAPRADISDFAPRIYTMKIDPKKIKDVIGKGGATIRALTEETGTSIDIDDDGTVKIA
AVDGNSAKEVMARIEDITAEVEAGAVYKGKVTRLADFGAFVSIVGNKEGLVHISQIAEER
VEKVSDYLAVGQEVTVKVVEIDRQGRIRLTMKEVAPKQEHVDSVVADVAAEENA
Download sequence
Identical sequences A0A1E3XLX6 Q9CLU1 V4N545
272843.PM1114 gi|378773733|ref|YP_005175976.1| gi|15602979|ref|NP_246051.1| WP_005723319.1.10027 WP_005723319.1.10721 WP_005723319.1.12311 WP_005723319.1.1307 WP_005723319.1.14908 WP_005723319.1.15732 WP_005723319.1.17217 WP_005723319.1.18123 WP_005723319.1.19996 WP_005723319.1.20287 WP_005723319.1.22153 WP_005723319.1.2313 WP_005723319.1.23830 WP_005723319.1.24757 WP_005723319.1.26616 WP_005723319.1.26777 WP_005723319.1.27416 WP_005723319.1.29697 WP_005723319.1.30617 WP_005723319.1.34253 WP_005723319.1.35978 WP_005723319.1.36022 WP_005723319.1.39152 WP_005723319.1.3957 WP_005723319.1.40210 WP_005723319.1.40787 WP_005723319.1.41297 WP_005723319.1.41462 WP_005723319.1.42943 WP_005723319.1.44741 WP_005723319.1.45422 WP_005723319.1.47685 WP_005723319.1.4808 WP_005723319.1.52066 WP_005723319.1.53852 WP_005723319.1.55074 WP_005723319.1.57420 WP_005723319.1.58450 WP_005723319.1.58628 WP_005723319.1.58910 WP_005723319.1.59455 WP_005723319.1.60664 WP_005723319.1.61098 WP_005723319.1.61860 WP_005723319.1.62016 WP_005723319.1.6219 WP_005723319.1.62389 WP_005723319.1.65482 WP_005723319.1.65878 WP_005723319.1.66934 WP_005723319.1.66990 WP_005723319.1.70689 WP_005723319.1.73917 WP_005723319.1.74955 WP_005723319.1.75804 WP_005723319.1.79593 WP_005723319.1.80223 WP_005723319.1.80589 WP_005723319.1.80911 WP_005723319.1.81885 WP_005723319.1.8281 WP_005723319.1.86541 WP_005723319.1.87897 WP_005723319.1.89773 WP_005723319.1.90081 WP_005723319.1.90179 WP_005723319.1.91495 WP_005723319.1.94435 WP_005723319.1.95718 WP_005723319.1.9746 gi|383309735|ref|YP_005362545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]