SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602983|ref|NP_246055.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602983|ref|NP_246055.1|
Domain Number 1 Region: 155-309
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 2.88e-48
Family GAPDH-like 0.000000805
Further Details:      
 
Domain Number 2 Region: 3-183
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.34e-45
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602983|ref|NP_246055.1|
Sequence length 335
Comment N-acetyl-gamma-glutamyl-phosphate reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQKAIIIGASGYTGAELARLLIKHPEFELTGLYVSRQSQDANKCISDIYPQLKHLVDLPL
QPLPEQLTQLAQQADLVFLATAHEVSHDLAPIFLQNQCKVFDLSGAFRVNNAAFYRTFYG
FEHQHPELLTQAVYGLAEWNAHQIKQTDLVAVAGCYPTVSQLSLKPLIAHNLLDLTQLPV
INAVSGVSGAGRKATLTSSFCEVSLNAYGVFNHRHQPEIATHLGTEVIFTPHLGNFKRGI
LATITAKLKTGVSDEQIRVAYQHAYADKPLVRVYEQGLPSIKAVEFTPYCDIGFVTKNGH
IIIIGAEDNLLKGAAAQAVQCANIRYGLTETLGLL
Download sequence
Identical sequences P57907
gi|15602983|ref|NP_246055.1| WP_010907026.1.12311 WP_010907026.1.15732 WP_010907026.1.19996 WP_010907026.1.27592 WP_010907026.1.40210 WP_010907026.1.41657 WP_010907026.1.42512 WP_010907026.1.45422 WP_010907026.1.4808 WP_010907026.1.53852 WP_010907026.1.6219 WP_010907026.1.62389 WP_010907026.1.66990 WP_010907026.1.81885 WP_010907026.1.8281 WP_010907026.1.89773 WP_010907026.1.94432 WP_010907026.1.9746 WP_010907026.1.9947 272843.PM1118 gi|386833651|ref|YP_006238965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]