SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603011|ref|NP_246083.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603011|ref|NP_246083.1|
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.82e-23
Family Phosphate binding protein-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603011|ref|NP_246083.1|
Sequence length 241
Comment molybdate ABC transporter periplasmic molybdate-binding protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRILAAGSLRQPFTLWQQALIQQYQLQVEIEFGPAGLLCQRIEQGEKVDLFASANDVHPR
SLQARYPHIQLVPFATNRLCLITKKSVITHHDENWLTLLMSPHLRLGVSTPKADPCGDYT
LALFSNIEKRHMGYGSKLKEKAMAIVGGPDSITIPTGRNTAEWLFEQNYADLFIGYASNH
QSLRQHSDICVLDIPDEYNVRANYTLAAFTAEALRLVDSLLCLTCGQKYLRDCGFLPANH
T
Download sequence
Identical sequences P57911
gi|15603011|ref|NP_246083.1| WP_010907043.1.12311 WP_010907043.1.15732 WP_010907043.1.19996 WP_010907043.1.40210 WP_010907043.1.45422 WP_010907043.1.4808 WP_010907043.1.53852 WP_010907043.1.6219 WP_010907043.1.62389 WP_010907043.1.66990 WP_010907043.1.81885 WP_010907043.1.8281 WP_010907043.1.89773 WP_010907043.1.9746 WP_010907043.1.9947 272843.PM1146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]