SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603040|ref|NP_246112.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603040|ref|NP_246112.1|
Domain Number 1 Region: 106-471
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 6.47e-136
Family Glutamine synthetase catalytic domain 0.0000000000661
Further Details:      
 
Domain Number 2 Region: 8-105
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 6.8e-32
Family Glutamine synthetase, N-terminal domain 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603040|ref|NP_246112.1|
Sequence length 472
Comment hypothetical protein PM1175 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSDTTAIANVFKLIEEYDIKFVLLRFTDIKGKEHGVSLPVNLVDEDLFEDGKMFDGSSVE
GWKAINKADMLLMPMPETAVVDPFAQIPTLSLRCSIYEPSTMQSYDRDPRSIAIRAENYM
RSTGIADEALFGPEPEFFLFDDVRFDVSMNRSSYSVDDIEAAWNTNKKYEDGNNAYRPLK
KGGYCAVAPIDSAHDIRSEMCLILEEMGLVIEAHHHEVATAGQNEIATRFNTLTTKADET
QIYKYVVQNVAYEHGKTACFMPKPITGDNGSGMHCNMSLSKDGKNVFQGDKYAGLSETAL
YYIGGIIKHAKALNAFTNPSTNSYKRLVPGFEAPVLLAYSASNRSASIRIPAVTNPKAIR
IEARFPDPLANPYLAFAALLMAGLDGIINKIHPGDAMDKNLYDLPPEELQNIPAVASSLE
EALNALEQDYEFLTKGNVFTQAFIDAFITIKRKEVERLNMTPHPVEFEMYYA
Download sequence
Identical sequences Q9CLP2
gi|15603040|ref|NP_246112.1| WP_010907056.1.12311 WP_010907056.1.15732 WP_010907056.1.19996 WP_010907056.1.40210 WP_010907056.1.45422 WP_010907056.1.4808 WP_010907056.1.53852 WP_010907056.1.6219 WP_010907056.1.62389 WP_010907056.1.66990 WP_010907056.1.81885 WP_010907056.1.8281 WP_010907056.1.89773 WP_010907056.1.9746 WP_010907056.1.9947 272843.PM1175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]