SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603058|ref|NP_246130.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603058|ref|NP_246130.1|
Domain Number 1 Region: 25-357
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.32e-93
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00000000452
Further Details:      
 
Domain Number 2 Region: 360-541
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.83e-53
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603058|ref|NP_246130.1|
Sequence length 549
Comment bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLTKLSAIALSLGLISQAYAYTQDKTYNITVLHANDTHGHFWKNSHGEYGFAAHKTLI
DNIRKEVEGKGGSVILLHAGDFNTGVPESDMQNAKPDIEGMNMIGYDVAVLGNHEFDFPM
QLLEMQEKWAKFPLISANVINKKTNKPLVKPYVILNKEDVKIAVVGLTTEDTAKLGNPDV
VDHVIFNNPIETAKNTLAEINQTEKPDIRIALTHMGYYFDGKHGHNAPGDVTMARTLDKG
AFDLIIGGHTHDTVCIDEQGQFKLKYTPGEACKPDFQNGTWIVQAGEWGKYIGRADFEFK
NGETKLVKYELIPINLKQKIKLEDGKSEYKLYQSEIAEDPAVFAHLKKYQDEGDRLLGVK
VGEVKGKFIGDRKIIRFHQTNLGRLIAQSQMERVKADVGIMNSGGIRTDINEGETTYKDL
LTVQPFGNMIATVDFTGQELLDYLNVVALKQVDSGAYPQFAGLSMVVDRTAQKVSDVKVG
GKALDLNKTYKVSVPDYCAGGGDGYPVLKKHPSYVNTGFIDAEMLKKYFEENKVLDASKY
DPKDDIIFK
Download sequence
Identical sequences Q9CLM8
WP_010907063.1.12311 WP_010907063.1.15732 WP_010907063.1.19996 WP_010907063.1.27592 WP_010907063.1.45422 WP_010907063.1.4808 WP_010907063.1.53852 WP_010907063.1.62389 WP_010907063.1.66990 WP_010907063.1.81885 WP_010907063.1.89773 WP_010907063.1.9746 WP_010907063.1.9947 272843.PM1193 gi|15603058|ref|NP_246130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]