SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603060|ref|NP_246132.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603060|ref|NP_246132.1|
Domain Number 1 Region: 6-223
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.49e-69
Family Phosphate binding protein-like 0.0000000293
Further Details:      
 
Domain Number 2 Region: 226-298
Classification Level Classification E-value
Superfamily GlnB-like 1.89e-22
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603060|ref|NP_246132.1|
Sequence length 299
Comment ATP phosphoribosyltransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIESKRLRIAMQKSGRLSQESQALLKQCGVKINLQEQRLIAYAENMPIDILRVRDDDIPG
LVFDGVVDLGIIGENVLEEEELTRQAAGETVNYKKLRRLDFGGCRLSIAIPQDEAYNGIS
DLKNARIATSYPNLLKRYMQQQGVDFKTCSLTGSVEVAPRAGLADAICDLVSSGATLEAN
GLKEVEIIYRSKSCLIQRAAELSPEKQALVDKLLTRIQGVQQAAESKYIMLHAPKEKLEE
ITALLPGVENPTILPLAHDNSKVAMHVVSQENLFWETMEQLKDAGASSILVLPIEKMMG
Download sequence
Identical sequences A0A1E3XJ72 A0A2K2YKM8 P57919 V4NAA2
gi|15603060|ref|NP_246132.1| WP_005717575.1.10027 WP_005717575.1.10721 WP_005717575.1.11014 WP_005717575.1.11214 WP_005717575.1.11947 WP_005717575.1.12156 WP_005717575.1.12311 WP_005717575.1.1307 WP_005717575.1.14908 WP_005717575.1.15732 WP_005717575.1.17217 WP_005717575.1.17980 WP_005717575.1.18123 WP_005717575.1.19996 WP_005717575.1.20287 WP_005717575.1.21657 WP_005717575.1.22153 WP_005717575.1.2313 WP_005717575.1.23830 WP_005717575.1.24757 WP_005717575.1.26616 WP_005717575.1.26777 WP_005717575.1.27416 WP_005717575.1.27592 WP_005717575.1.27664 WP_005717575.1.28084 WP_005717575.1.29697 WP_005717575.1.30617 WP_005717575.1.34253 WP_005717575.1.35562 WP_005717575.1.35978 WP_005717575.1.36022 WP_005717575.1.3807 WP_005717575.1.38246 WP_005717575.1.3839 WP_005717575.1.39152 WP_005717575.1.3957 WP_005717575.1.40210 WP_005717575.1.40787 WP_005717575.1.41297 WP_005717575.1.41351 WP_005717575.1.41462 WP_005717575.1.41657 WP_005717575.1.41667 WP_005717575.1.42469 WP_005717575.1.42512 WP_005717575.1.42943 WP_005717575.1.43687 WP_005717575.1.44741 WP_005717575.1.45422 WP_005717575.1.47685 WP_005717575.1.4808 WP_005717575.1.49053 WP_005717575.1.50853 WP_005717575.1.51342 WP_005717575.1.52066 WP_005717575.1.52585 WP_005717575.1.52859 WP_005717575.1.55074 WP_005717575.1.55401 WP_005717575.1.57420 WP_005717575.1.57956 WP_005717575.1.58111 WP_005717575.1.58257 WP_005717575.1.58450 WP_005717575.1.58628 WP_005717575.1.58910 WP_005717575.1.59455 WP_005717575.1.60478 WP_005717575.1.60664 WP_005717575.1.61098 WP_005717575.1.61860 WP_005717575.1.62016 WP_005717575.1.6219 WP_005717575.1.62389 WP_005717575.1.6332 WP_005717575.1.63549 WP_005717575.1.65482 WP_005717575.1.65878 WP_005717575.1.66934 WP_005717575.1.66990 WP_005717575.1.70689 WP_005717575.1.72215 WP_005717575.1.73917 WP_005717575.1.74955 WP_005717575.1.75804 WP_005717575.1.78987 WP_005717575.1.79347 WP_005717575.1.80223 WP_005717575.1.80589 WP_005717575.1.80911 WP_005717575.1.81885 WP_005717575.1.8281 WP_005717575.1.86541 WP_005717575.1.87897 WP_005717575.1.88402 WP_005717575.1.89773 WP_005717575.1.90081 WP_005717575.1.90179 WP_005717575.1.90578 WP_005717575.1.91495 WP_005717575.1.92478 WP_005717575.1.93940 WP_005717575.1.94432 WP_005717575.1.94435 WP_005717575.1.95718 WP_005717575.1.9746 WP_005717575.1.9947 272843.PM1195 gi|386835804|ref|YP_006241124.1| gi|378775762|ref|YP_005178005.1| gi|383311850|ref|YP_005364660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]