SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603065|ref|NP_246137.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603065|ref|NP_246137.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily HAD-like 1.68e-35
Family Histidinol phosphatase-like 0.00000234
Further Details:      
 
Domain Number 2 Region: 175-259
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-32
Family Imidazole glycerol phosphate dehydratase 0.00017
Further Details:      
 
Domain Number 3 Region: 260-350
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.07e-30
Family Imidazole glycerol phosphate dehydratase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603065|ref|NP_246137.1|
Sequence length 363
Comment imidazole glycerol-phosphate dehydratase/histidinol phosphatase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTQQSILFIDRDGTLIDEPKTDFQIDSLEKLQFEPNVIPALLKLKPYYRFVMVSNQDGLG
TASFPQENFDKPHNAMMALFKSQGIEFDEVLICPHKPEDECDCRKPKIKLLKKYIDKKLF
DPTTSFVIGDRATDVQLAENLGIRALQYDREKLNWDLIVEKLLPKQTALLDRKPRYAEVV
RTTKETDIKVQVWLDETGMNDIKTGVGFFDHMLDQIATHGGFRMNVYCKGDLWIDEHHTV
EDTALALGTALKQALGDKRGIQRFGFVLPMDECKAECTMDLSGRPYFKFKAKFKRDKVGD
FSTEMTEHFFQSLAYTLMATLHLKTKGDNDHHKIESLFKVFGRTLRQCIKVEGNELPSSK
GVL
Download sequence
Identical sequences P57920
gi|15603065|ref|NP_246137.1| WP_010907067.1.12311 WP_010907067.1.15732 WP_010907067.1.19996 WP_010907067.1.40210 WP_010907067.1.45422 WP_010907067.1.4808 WP_010907067.1.53852 WP_010907067.1.6219 WP_010907067.1.62389 WP_010907067.1.66990 WP_010907067.1.81885 WP_010907067.1.8281 WP_010907067.1.89773 WP_010907067.1.9746 WP_010907067.1.9947 272843.PM1200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]