SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603084|ref|NP_246156.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603084|ref|NP_246156.1|
Domain Number 1 Region: 5-228,368-415
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.03e-81
Family Tandem AAA-ATPase domain 0.000000177
Further Details:      
 
Domain Number 2 Region: 620-840,869-881
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 7.06e-80
Family Helical scaffold and wing domains of SecA 0.0000102
Further Details:      
 
Domain Number 3 Region: 416-609
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-55
Family Tandem AAA-ATPase domain 0.0000041
Further Details:      
 
Domain Number 4 Region: 227-368
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 4.97e-43
Family Pre-protein crosslinking domain of SecA 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603084|ref|NP_246156.1|
Sequence length 895
Comment preprotein translocase subunit SecA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFRSILTKIFGSRNDRILRRLNKIVIKINQLEPEFEALSDDDLKAKTDAFKARLAQGETL
EQLLPEAFATVREASKRVLGMRHFDVQLLGGMVLTNRCIAEMRTGEGKTLTATLPCYLNA
LTGKGVHVVTVNDYLARRDAETNRPLFEFLGMTVGVNVPGLSPEQKREAYAADVTYATNS
ELGFDYLRDNLAHTAQERFQRYLHYALVDEVDSILIDEARTPLIISGQAEDSSELYMTVD
KLIPDLIKQDKEDSEEYQGEGDFTLDLKTKQAHLTERGQEKVEQWLTEQGLMSAEESLYS
PSKISLLHHVYAALRAHTLFERDVDYIVKDGEIVIVDEHTGRTMAGRRWSDGLHQAIEAK
EGVRIQSENQTVASITYQNYFRLYEKLAGMTGTADTEAFEFQQIYGLETIVVPTNRPMIR
DDRTDVMFENEEYKFNAIIEDIKDCVARNQPVLVGTISIEKSELLSHALKKAGIKHNVLN
AKFHAQEAEIVANAGYPGTVTIATNMAGRGTDIVLGGNWKAEIAKLDNPTEAQIEAIHTA
WKARHEIVKAAGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSLDDALMRIYLN
EGKLNLMRKAFSTAGEAMESKMLTKVIASAQAKVEAHNFDGRKNLLEFDDVANDQRHAIY
AQRNTLLDNEDISDTIDVIRADVFNQVIDQYIPPQSLEEMWDVPALEQRLKHDFALDLPL
EKWLEEDNHFDEDALRQRVLDAAIEEYKQKESIVGEQTMRSFEKGVMLQTLDELWKEHLS
AMDHLRRGIHLRGYAQKDPKQEYKKECFQMFTDMLDALKLSVVTTLSRVQVRTQEEVEQA
ERQRQEMAKRETASMQYNADEDSGEENTRRVGRNEPCPCGSGKKYKHCHGSKAKY
Download sequence
Identical sequences Q9CLK7
272843.PM1219 WP_010907079.1.12311 WP_010907079.1.15732 WP_010907079.1.19996 WP_010907079.1.40210 WP_010907079.1.45422 WP_010907079.1.4808 WP_010907079.1.53852 WP_010907079.1.6219 WP_010907079.1.62389 WP_010907079.1.66990 WP_010907079.1.81885 WP_010907079.1.8281 WP_010907079.1.89773 WP_010907079.1.9746 WP_010907079.1.9947 gi|15603084|ref|NP_246156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]