SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603106|ref|NP_246178.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603106|ref|NP_246178.1|
Domain Number 1 Region: 113-455
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.91e-93
Family Sigma2 domain of RNA polymerase sigma factors 0.00000000468
Further Details:      
 
Domain Number 2 Region: 518-620
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.05e-26
Family Sigma4 domain 0.0000812
Further Details:      
 
Domain Number 3 Region: 461-534
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 4.11e-21
Family Sigma3 domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603106|ref|NP_246178.1|
Sequence length 622
Comment RNA polymerase sigma factor RpoD [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDQNPQSQLKLLIAQGKEQGYLTYAEVNDHLPEELVDAEQIEDIIQMINDMGIQVLESAP
DADDLMLNETIADEDAVEEATQVLSSVEAEIGRTTDPVRMYMREMGSVELLTREGEIDIA
KRIEEGINEVQSAIAFYPEAISYLLDQYALVEEGGVRLADLITGFVDPNAMTESDVAEIE
DTFDEDEDSDSVSATLNEEEEEEEESEEESTTDDSDSDNSIDPEVAREKFLELKTQHAKA
VAMIEKHGRTSKKSKDQIQALADVFTQFRLVPKQFDTLVNLMSNMMKSVRLQERSIQKIV
VDKAKMPKEQFQKVFIGHENKDTWLVKALSSGKTWSEKLAKHEEEIRYYIDNILEIERQT
NLTVSQIREVCERISAGELKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIG
LMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQML
QEMGREASPEELAERMGMPEDKIRKVLKIAKEPISMETPIGDDDDSHLGDFIEDSTLELP
LDSATAQSLKVATHEVLEGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIE
AKALRKLRHPSRSETLRSFLDE
Download sequence
Identical sequences Q9CLI8
gi|15603106|ref|NP_246178.1| WP_010907089.1.12311 WP_010907089.1.15732 WP_010907089.1.19996 WP_010907089.1.26777 WP_010907089.1.62389 WP_010907089.1.66990 WP_010907089.1.81885 272843.PM1241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]