SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603114|ref|NP_246186.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603114|ref|NP_246186.1|
Domain Number 1 Region: 61-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.57e-37
Family L-arabinose binding protein-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603114|ref|NP_246186.1|
Sequence length 369
Comment hypothetical protein PM1249 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKQQFHRGLSALAALVTLSFATQALANDPFVAEAKQHVAAATAQQTVWDGPTTGPKLQPS
KNVIFVASDMKNGGVLGVIDGMKEATAVAGWKFDVLDGAGSVNNQLSALNQAIARKPDAI
VIGGWNPNVAKIPLGKANKNGITLVAWHATPEPGPIDKYNIFYNVTSDSDQIAKLSAQLA
VANSDGKAKVVILTDSLYEIALRKANVMKDVIEQCKECKVLEFIDTPLADTSSRMPSLTF
SLLQKYGDDLQYTLAINDLYFDFMAPSLRSANKGEMPYNISAGDGSVTAYQRIRTNNHQF
ATVPEPLNLHGWQLVDELNRAFAKEKPSGYITPAHLVIKDNVAFDGGEKNLYDPQNGYKD
AYKRIWDVK
Download sequence
Identical sequences A0A1D7R4V0 A0A2K2YLQ6 Q9CLI2 V4MT13
272843.PM1249 gi|15603114|ref|NP_246186.1| gi|378775493|ref|YP_005177736.1| WP_005754781.1.10027 WP_005754781.1.10721 WP_005754781.1.12311 WP_005754781.1.1307 WP_005754781.1.14908 WP_005754781.1.15732 WP_005754781.1.17217 WP_005754781.1.18123 WP_005754781.1.19996 WP_005754781.1.20287 WP_005754781.1.22153 WP_005754781.1.2313 WP_005754781.1.23830 WP_005754781.1.24757 WP_005754781.1.26616 WP_005754781.1.26777 WP_005754781.1.27416 WP_005754781.1.27664 WP_005754781.1.29697 WP_005754781.1.30617 WP_005754781.1.34253 WP_005754781.1.35978 WP_005754781.1.39152 WP_005754781.1.3957 WP_005754781.1.40210 WP_005754781.1.40787 WP_005754781.1.41462 WP_005754781.1.42943 WP_005754781.1.44741 WP_005754781.1.45422 WP_005754781.1.47685 WP_005754781.1.4808 WP_005754781.1.50853 WP_005754781.1.52066 WP_005754781.1.53852 WP_005754781.1.57420 WP_005754781.1.58450 WP_005754781.1.58628 WP_005754781.1.58910 WP_005754781.1.59455 WP_005754781.1.60664 WP_005754781.1.61098 WP_005754781.1.61860 WP_005754781.1.62016 WP_005754781.1.6219 WP_005754781.1.62389 WP_005754781.1.65482 WP_005754781.1.65878 WP_005754781.1.66934 WP_005754781.1.66990 WP_005754781.1.73917 WP_005754781.1.74955 WP_005754781.1.75804 WP_005754781.1.80223 WP_005754781.1.80589 WP_005754781.1.80911 WP_005754781.1.81885 WP_005754781.1.8281 WP_005754781.1.86541 WP_005754781.1.87897 WP_005754781.1.89773 WP_005754781.1.90081 WP_005754781.1.90179 WP_005754781.1.91495 WP_005754781.1.94435 WP_005754781.1.9746 WP_005754781.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]