SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603117|ref|NP_246189.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603117|ref|NP_246189.1|
Domain Number 1 Region: 73-122,155-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000177
Family Phosphate binding protein-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603117|ref|NP_246189.1|
Sequence length 328
Comment hypothetical protein PM1252 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKRFNLKMLAALVAGMAVFTASANAATTLRFGYEAPRSDTQHEAAKKFNELLKEKTKGEI
KLSLFPDSTLGNAQTMISAVRGGTIDLEMSGSPNFSGLVPKLNVIDIPFIFQNREHAYAV
LDGEIGQGLLKELEAQGLKGLAFWEVGFRSFTNSKHPVKTPDDIKGLKVRTNQNPMYIQA
FSILGANPVPMPLSELYTALETRAVDAQEHPVGIVWSAKLYEVQKHLSLTNHGYTPLIVV
MNKAKFDGLSPALQSAILEAAKEAGAYQRKLNLDNEKGIIEKMQKAGIQVIETVDTKPFK
AAIESEVRKAFIEKNGDDLVKQIDALAK
Download sequence
Identical sequences A0A1E3XLH0 Q9CLH9 V4NBG1
272843.PM1252 gi|15603117|ref|NP_246189.1| gi|383311503|ref|YP_005364313.1| WP_005717703.1.10027 WP_005717703.1.11014 WP_005717703.1.11214 WP_005717703.1.11947 WP_005717703.1.12156 WP_005717703.1.12311 WP_005717703.1.1307 WP_005717703.1.14908 WP_005717703.1.15732 WP_005717703.1.17217 WP_005717703.1.17980 WP_005717703.1.19996 WP_005717703.1.20287 WP_005717703.1.21657 WP_005717703.1.22153 WP_005717703.1.2313 WP_005717703.1.23830 WP_005717703.1.26616 WP_005717703.1.26777 WP_005717703.1.27416 WP_005717703.1.28084 WP_005717703.1.29697 WP_005717703.1.30617 WP_005717703.1.34253 WP_005717703.1.35562 WP_005717703.1.35978 WP_005717703.1.36022 WP_005717703.1.3807 WP_005717703.1.38246 WP_005717703.1.3839 WP_005717703.1.39152 WP_005717703.1.3957 WP_005717703.1.40210 WP_005717703.1.41297 WP_005717703.1.41351 WP_005717703.1.41462 WP_005717703.1.41657 WP_005717703.1.41667 WP_005717703.1.42469 WP_005717703.1.42512 WP_005717703.1.43687 WP_005717703.1.44741 WP_005717703.1.45422 WP_005717703.1.47685 WP_005717703.1.4808 WP_005717703.1.49053 WP_005717703.1.50853 WP_005717703.1.51342 WP_005717703.1.52066 WP_005717703.1.52585 WP_005717703.1.52859 WP_005717703.1.53852 WP_005717703.1.55074 WP_005717703.1.55401 WP_005717703.1.57420 WP_005717703.1.57956 WP_005717703.1.58111 WP_005717703.1.58257 WP_005717703.1.58450 WP_005717703.1.58628 WP_005717703.1.59455 WP_005717703.1.60478 WP_005717703.1.60664 WP_005717703.1.61098 WP_005717703.1.61860 WP_005717703.1.62016 WP_005717703.1.6219 WP_005717703.1.62389 WP_005717703.1.6332 WP_005717703.1.63549 WP_005717703.1.65482 WP_005717703.1.65878 WP_005717703.1.66934 WP_005717703.1.66990 WP_005717703.1.72215 WP_005717703.1.73917 WP_005717703.1.74955 WP_005717703.1.75804 WP_005717703.1.78987 WP_005717703.1.79347 WP_005717703.1.80589 WP_005717703.1.80911 WP_005717703.1.81885 WP_005717703.1.8281 WP_005717703.1.83579 WP_005717703.1.86541 WP_005717703.1.87897 WP_005717703.1.88402 WP_005717703.1.89773 WP_005717703.1.90179 WP_005717703.1.90578 WP_005717703.1.91495 WP_005717703.1.92478 WP_005717703.1.93940 WP_005717703.1.94432 WP_005717703.1.95718 WP_005717703.1.9746 WP_005717703.1.9947 gi|386835746|ref|YP_006241066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]