SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15603122|ref|NP_246194.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603122|ref|NP_246194.1|
Domain Number 1 Region: 83-264
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-43
Family IclR ligand-binding domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 17-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000351
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603122|ref|NP_246194.1|
Sequence length 269
Comment hypothetical protein PM1257 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDVMKEEDKTKKAGSNQSLIRGLLLIDILSNFPNGCPLAKLSELSNLNKSTTHRMLQTLQ
SCGYVKPANTLGAYRLTTKCLTLGQKTLSSLNILNLTAPYLEQLNLETGETVNLSTRDHH
HAVMIYKLEPTTGMLRTRAYIGQRLELYCSAMGKIFMAYEKGHALDDYWEKNQATIQQLT
VNTIVTQEAMALELAKIRELGYAMDNEENERGVTCLACPVFDIHGNVTYSVSISLSTARL
KQIGQDTLLRHLKQTTQAISQELGAVMPS
Download sequence
Identical sequences A0A1E3XLI0 J4SIN1 Q9CLH4 V4NBF6
gi|378775501|ref|YP_005177744.1| 272843.PM1257 gi|386835741|ref|YP_006241061.1| gi|15603122|ref|NP_246194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]