SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603128|ref|NP_246200.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603128|ref|NP_246200.1|
Domain Number 1 Region: 28-309
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.65e-47
Family Phosphate binding protein-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603128|ref|NP_246200.1|
Sequence length 315
Comment hypothetical protein PM1263 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQKLVKKTLTVAFAMGVSLSVSAKEKLTLLLDWFVNPDHAAIIVAQQKGYFAQQGLDVEI
VEPADPSLPPKLVAAGKADLAVDYQPQLQIQVAEDLPLTRVGTLVATPLNSLIVLEKSAI
KSLADLKGKKIGYSVSGFEDSLLKAMLGSANLTDKDIEMVNVNWSLSPSLISGQVDAVIG
GFRNFELNQMKLEKQPGRAFYPEEHGVPVYDELILVANKNTMPTEKISKFLTALEQATIY
TLNHPQAAWETFVAYKEKELNNDLNRLAWTDTLPRLALRPRALDSHRYERMAEFLKANGL
TKVVKPLSDYAIEIK
Download sequence
Identical sequences Q9CLH1
gi|15603128|ref|NP_246200.1| 272843.PM1263 WP_010907097.1.12311 WP_010907097.1.15732 WP_010907097.1.19996 WP_010907097.1.40210 WP_010907097.1.4808 WP_010907097.1.53852 WP_010907097.1.6219 WP_010907097.1.62389 WP_010907097.1.66990 WP_010907097.1.81885 WP_010907097.1.8281 WP_010907097.1.89773 WP_010907097.1.9746 WP_010907097.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]