SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603136|ref|NP_246208.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603136|ref|NP_246208.1|
Domain Number 1 Region: 102-263
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.82e-36
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 3.74e-29
Family Shikimate dehydrogenase-like 0.00000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603136|ref|NP_246208.1|
Sequence length 269
Comment shikimate 5-dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDKYAVWGNPIAQSKSPQIHQIFANQTQQQMEYVAMLGDEQDFEQQLRVFFEKGAKGCNI
TAPFKERAFQLADLHSERCLTAEACNTLKKLDDGRLYGDNTDGAGLVSDLQRLGWLKPEQ
TILILGAGGATKGVLLPLLQAKQHIVLANRTLSKAEDLAQKFAQYGQIQAVELDNIPVQS
FDLIINATSSGLHGQTVQMNPEILQNATALYDMQYAKQADTPFVALCKQLGKQNVSDGFG
MLVAQAAHAFHLWRGVMPEFEALLEQEWL
Download sequence
Identical sequences P57932
gi|15603136|ref|NP_246208.1| WP_010907104.1.12311 WP_010907104.1.15732 WP_010907104.1.19996 WP_010907104.1.27592 WP_010907104.1.40210 WP_010907104.1.41297 WP_010907104.1.41657 WP_010907104.1.42512 WP_010907104.1.45422 WP_010907104.1.4808 WP_010907104.1.53852 WP_010907104.1.57956 WP_010907104.1.6219 WP_010907104.1.62389 WP_010907104.1.66990 WP_010907104.1.81885 WP_010907104.1.8281 WP_010907104.1.89773 WP_010907104.1.94432 WP_010907104.1.9746 WP_010907104.1.9947 gi|386835726|ref|YP_006241046.1| 272843.PM1271 gi|383311523|ref|YP_005364333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]