SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603142|ref|NP_246214.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603142|ref|NP_246214.1|
Domain Number 1 Region: 26-338
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.66e-83
Family L-arabinose binding protein-like 0.000000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603142|ref|NP_246214.1|
Sequence length 338
Comment hypothetical protein PM1277 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKNQLKATALAIAVGLSALGTAQAADRIAFIPKLVGVGFFTSGGQGATEMGKTLGVDVTY
DGPTEPSVSNQVQLINNFVNQGYNAIVVSAVSPDGLCSTLQRAMKRGVKVLTWDSDTKPE
CRSHYINQGTPEQLGSMLVDMASSQMSKPKAKVAFFYSSPTVTDQNQWVKEAKAKIAKDH
PEWEIVTTQFGYNDAIKSLQTAEGILKAYPDLDAIIAPDANALPAAAQAAENLKVNNVVI
VGFSTPNVMRPYVQRGTVKQFGLWDVVQQGKISIAVANELLKGKALNVGDKVDVQGIGTV
EVSPNKVQGYEYEAKGNGIILLPERVVFTKENIDNYNF
Download sequence
Identical sequences A0A1E3XLH2 Q9CLF8
WP_005723803.1.11214 WP_005723803.1.11947 WP_005723803.1.12156 WP_005723803.1.12311 WP_005723803.1.14908 WP_005723803.1.15732 WP_005723803.1.17980 WP_005723803.1.19996 WP_005723803.1.21657 WP_005723803.1.24757 WP_005723803.1.26777 WP_005723803.1.27592 WP_005723803.1.28084 WP_005723803.1.35562 WP_005723803.1.36022 WP_005723803.1.3807 WP_005723803.1.38246 WP_005723803.1.3839 WP_005723803.1.3957 WP_005723803.1.40210 WP_005723803.1.40787 WP_005723803.1.41297 WP_005723803.1.41351 WP_005723803.1.41657 WP_005723803.1.41667 WP_005723803.1.42512 WP_005723803.1.43687 WP_005723803.1.45422 WP_005723803.1.4808 WP_005723803.1.49053 WP_005723803.1.51342 WP_005723803.1.52585 WP_005723803.1.52859 WP_005723803.1.53852 WP_005723803.1.55074 WP_005723803.1.55401 WP_005723803.1.57956 WP_005723803.1.58111 WP_005723803.1.58257 WP_005723803.1.60478 WP_005723803.1.61098 WP_005723803.1.6219 WP_005723803.1.62389 WP_005723803.1.6332 WP_005723803.1.63549 WP_005723803.1.66990 WP_005723803.1.70689 WP_005723803.1.72215 WP_005723803.1.78987 WP_005723803.1.79347 WP_005723803.1.79593 WP_005723803.1.81885 WP_005723803.1.8281 WP_005723803.1.83579 WP_005723803.1.88402 WP_005723803.1.89773 WP_005723803.1.92478 WP_005723803.1.93940 WP_005723803.1.94432 WP_005723803.1.95718 WP_005723803.1.9746 272843.PM1277 gi|15603142|ref|NP_246214.1| gi|386835720|ref|YP_006241040.1| gi|383311529|ref|YP_005364339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]