SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603148|ref|NP_246220.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603148|ref|NP_246220.1|
Domain Number 1 Region: 88-292
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.78e-32
Family Phosphate binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.16e-20
Family LysR-like transcriptional regulators 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603148|ref|NP_246220.1|
Sequence length 293
Comment DNA-binding transcriptional regulator IlvY [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNFTYLKLFLHLCETKNFAKTAAQNHMSPSTLSRQIQRMEQDVGQILFLRNNRQVELTDA
GEKLLPFAQQSWMQWQQIKQQLRDSAQQELNGELKLFCSVTAAYSHLPAILERFRTRYPK
VEIQLTTGDPSLALQLVETQQVDLALAGQPKNLPNHIAFHYIDDISLSLIAPRIACSATQ
LLQQTPINWQQIPFILPVEGPARQRIDQWFKQQKIKHPKIYATVAGHEAIMPMVALGCGV
AMLPDVVIKNSPMNSQVSILHLKTPITPFALGICVQKKSLTQPLVRAFWQILQ
Download sequence
Identical sequences Q9CLF2
gi|15603148|ref|NP_246220.1| 272843.PM1283 WP_010907110.1.12311 WP_010907110.1.15732 WP_010907110.1.19996 WP_010907110.1.40210 WP_010907110.1.45422 WP_010907110.1.4808 WP_010907110.1.53852 WP_010907110.1.6219 WP_010907110.1.62389 WP_010907110.1.66990 WP_010907110.1.81885 WP_010907110.1.8281 WP_010907110.1.89773 WP_010907110.1.9746 WP_010907110.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]