SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603149|ref|NP_246221.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603149|ref|NP_246221.1|
Domain Number 1 Region: 28-209
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.61e-57
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000952
Further Details:      
 
Domain Number 2 Region: 210-370
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.45e-40
Family Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) 0.0088
Further Details:      
 
Domain Number 3 Region: 348-485
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.89e-40
Family Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603149|ref|NP_246221.1|
Sequence length 491
Comment ketol-acid reductoisomerase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MANYFNTLNLRQQLDQLGRCRFMDRNEFANEADYLKGKKIVIVGCGAQGLNQGLNMRDSG
LDISYALRAEAIAEKRASFQRATENGFKVGTYDELIPSADLVVNLTPDKQHSKVVADVMP
LMKQGAALGYSHGLNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPNGDGLEIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSIVCYDKL
VADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELSEQIKAKLTFLF
EKHMDDIISGEFSATMMADWANGDANLLKWREETGKTAFENAPKYEGKISEQEYFDHGVL
MVAMVKAGVELAFDTMVASGIYEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFANVATPILAKEIMPTLQKGDLGEPTPTVEIDNITLRDVNDAIRNHPIELIGQELRG
YMTDMKRISSH
Download sequence
Identical sequences Q9CLF1
WP_005757467.1.11014 WP_005757467.1.12311 WP_005757467.1.15732 WP_005757467.1.17980 WP_005757467.1.19996 WP_005757467.1.26777 WP_005757467.1.27592 WP_005757467.1.40210 WP_005757467.1.41297 WP_005757467.1.41351 WP_005757467.1.41657 WP_005757467.1.41667 WP_005757467.1.42469 WP_005757467.1.42512 WP_005757467.1.45422 WP_005757467.1.4808 WP_005757467.1.53852 WP_005757467.1.55074 WP_005757467.1.57956 WP_005757467.1.58111 WP_005757467.1.6219 WP_005757467.1.62389 WP_005757467.1.66990 WP_005757467.1.79593 WP_005757467.1.81885 WP_005757467.1.8281 WP_005757467.1.88402 WP_005757467.1.89773 WP_005757467.1.90578 WP_005757467.1.92478 WP_005757467.1.93940 WP_005757467.1.94432 WP_005757467.1.9746 WP_005757467.1.9947 gi|383311536|ref|YP_005364346.1| 272843.PM1284 gi|15603149|ref|NP_246221.1| gi|386835713|ref|YP_006241033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]