SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603151|ref|NP_246223.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603151|ref|NP_246223.1|
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.81e-32
Family Universal stress protein-like 0.000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603151|ref|NP_246223.1|
Sequence length 141
Comment hypothetical protein PM1286 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MYKHVLVAVDLSDESQFLLEKAAGVARRNEAKLSIIHVDVNFSDLYTGLIDVNMASMQDR
ISTETQQSLVQLAENSSYPVAEKLSGSGDLGQVLADAIEKYDVDLLVTGHHQDFWSKLMS
STRQVMNNIAVDMLVVPLRDE
Download sequence
Identical sequences A0A126QEQ8 A0A2K2YL47 J5NAA3 Q9CLE9 V4NGT4
gi|15603151|ref|NP_246223.1| 272843.PM1286 gi|386835711|ref|YP_006241031.1| gi|383311538|ref|YP_005364348.1| WP_005717764.1.10027 WP_005717764.1.10721 WP_005717764.1.11014 WP_005717764.1.11214 WP_005717764.1.11947 WP_005717764.1.12156 WP_005717764.1.12311 WP_005717764.1.1307 WP_005717764.1.14908 WP_005717764.1.15732 WP_005717764.1.17217 WP_005717764.1.17980 WP_005717764.1.18123 WP_005717764.1.19996 WP_005717764.1.20287 WP_005717764.1.21657 WP_005717764.1.22153 WP_005717764.1.2313 WP_005717764.1.23830 WP_005717764.1.24757 WP_005717764.1.26616 WP_005717764.1.26777 WP_005717764.1.27416 WP_005717764.1.27592 WP_005717764.1.27664 WP_005717764.1.28084 WP_005717764.1.29697 WP_005717764.1.30617 WP_005717764.1.34253 WP_005717764.1.35562 WP_005717764.1.35978 WP_005717764.1.36022 WP_005717764.1.3807 WP_005717764.1.38246 WP_005717764.1.3839 WP_005717764.1.39152 WP_005717764.1.3957 WP_005717764.1.40210 WP_005717764.1.40787 WP_005717764.1.41297 WP_005717764.1.41351 WP_005717764.1.41462 WP_005717764.1.41657 WP_005717764.1.41667 WP_005717764.1.4211 WP_005717764.1.42469 WP_005717764.1.42512 WP_005717764.1.42943 WP_005717764.1.43687 WP_005717764.1.44741 WP_005717764.1.45422 WP_005717764.1.47685 WP_005717764.1.4808 WP_005717764.1.49053 WP_005717764.1.50853 WP_005717764.1.51342 WP_005717764.1.52066 WP_005717764.1.52585 WP_005717764.1.52859 WP_005717764.1.53852 WP_005717764.1.55074 WP_005717764.1.55401 WP_005717764.1.57420 WP_005717764.1.57956 WP_005717764.1.58111 WP_005717764.1.58257 WP_005717764.1.58450 WP_005717764.1.58628 WP_005717764.1.58910 WP_005717764.1.59455 WP_005717764.1.60478 WP_005717764.1.60664 WP_005717764.1.61098 WP_005717764.1.61860 WP_005717764.1.62016 WP_005717764.1.6219 WP_005717764.1.62389 WP_005717764.1.6332 WP_005717764.1.63549 WP_005717764.1.65482 WP_005717764.1.65878 WP_005717764.1.66934 WP_005717764.1.66990 WP_005717764.1.72215 WP_005717764.1.73917 WP_005717764.1.74955 WP_005717764.1.75804 WP_005717764.1.78987 WP_005717764.1.79347 WP_005717764.1.79593 WP_005717764.1.80223 WP_005717764.1.80589 WP_005717764.1.80911 WP_005717764.1.81885 WP_005717764.1.8281 WP_005717764.1.83579 WP_005717764.1.86541 WP_005717764.1.87897 WP_005717764.1.88402 WP_005717764.1.89773 WP_005717764.1.90081 WP_005717764.1.90179 WP_005717764.1.90578 WP_005717764.1.91495 WP_005717764.1.92478 WP_005717764.1.93940 WP_005717764.1.94432 WP_005717764.1.94435 WP_005717764.1.95718 WP_005717764.1.9746 WP_005717764.1.9947 gi|378775531|ref|YP_005177774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]