SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603201|ref|NP_246275.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603201|ref|NP_246275.1|
Domain Number 1 Region: 23-262
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.41e-55
Family N-type ATP pyrophosphatases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603201|ref|NP_246275.1|
Sequence length 383
Comment tRNA-specific 2-thiouridylase MnmA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKSKTYETHFPPLSAEQLAENRKKKVICGMSGGVDSSVSAFILQQQGYQVEGLFMKNWEE
DDDTDYCTAAADLADAQAVCDKLGIKLHKINFAAEYWDNVFEHFLQEYKAGRTPNPDILC
NKEIKFKAFLDYAAEDLGADYIATGHYVRRGEKDGQCQLLRGLDNNKDQSYFLYTLSKDQ
VAQSLFPVGEIEKPIVRAIAEDLGLATAKKKDSTGICFIGERKFKDFLARYLPAQPGEIR
TVEGKVVGRHDGLMYHTLGQRKGLGIGGVKGMGEDPFYVVEKDLVNNVLVVAQGHDNSAL
LSSGLIASQLHWVDRQPIRQPVRCTVKTRYRQEDIPCEIQPINDETIRVVFDEPQIAVTP
GQSAVFYQGEICLGGGVIETQIK
Download sequence
Identical sequences A0A1D7R4K4 Q9CLA3 V4PZS2
gi|378775583|ref|YP_005177826.1| 272843.PM1336 WP_010907131.1.10027 WP_010907131.1.10721 WP_010907131.1.11214 WP_010907131.1.11947 WP_010907131.1.12156 WP_010907131.1.12311 WP_010907131.1.1307 WP_010907131.1.15732 WP_010907131.1.17217 WP_010907131.1.18123 WP_010907131.1.19996 WP_010907131.1.20287 WP_010907131.1.21657 WP_010907131.1.22153 WP_010907131.1.2313 WP_010907131.1.23830 WP_010907131.1.26616 WP_010907131.1.26777 WP_010907131.1.27416 WP_010907131.1.28084 WP_010907131.1.29697 WP_010907131.1.30617 WP_010907131.1.34253 WP_010907131.1.35562 WP_010907131.1.35978 WP_010907131.1.3807 WP_010907131.1.38246 WP_010907131.1.3839 WP_010907131.1.39152 WP_010907131.1.40210 WP_010907131.1.41351 WP_010907131.1.41462 WP_010907131.1.41667 WP_010907131.1.42943 WP_010907131.1.43687 WP_010907131.1.44741 WP_010907131.1.45422 WP_010907131.1.47685 WP_010907131.1.4808 WP_010907131.1.49053 WP_010907131.1.50853 WP_010907131.1.51342 WP_010907131.1.52066 WP_010907131.1.52585 WP_010907131.1.52859 WP_010907131.1.53852 WP_010907131.1.55074 WP_010907131.1.55401 WP_010907131.1.57420 WP_010907131.1.58111 WP_010907131.1.58257 WP_010907131.1.58450 WP_010907131.1.58628 WP_010907131.1.58910 WP_010907131.1.59455 WP_010907131.1.60478 WP_010907131.1.60664 WP_010907131.1.61860 WP_010907131.1.62016 WP_010907131.1.6219 WP_010907131.1.62389 WP_010907131.1.6332 WP_010907131.1.63549 WP_010907131.1.65482 WP_010907131.1.65878 WP_010907131.1.66934 WP_010907131.1.66990 WP_010907131.1.70689 WP_010907131.1.72215 WP_010907131.1.73917 WP_010907131.1.74955 WP_010907131.1.75804 WP_010907131.1.78987 WP_010907131.1.79347 WP_010907131.1.80223 WP_010907131.1.80589 WP_010907131.1.80911 WP_010907131.1.81885 WP_010907131.1.8281 WP_010907131.1.83579 WP_010907131.1.86541 WP_010907131.1.87897 WP_010907131.1.88402 WP_010907131.1.89773 WP_010907131.1.90081 WP_010907131.1.90179 WP_010907131.1.91495 WP_010907131.1.92478 WP_010907131.1.93940 WP_010907131.1.94435 WP_010907131.1.9746 WP_010907131.1.9947 gi|15603201|ref|NP_246275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]