SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603205|ref|NP_246279.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603205|ref|NP_246279.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily CheY-like 3.98e-28
Family CheY-related 0.00057
Further Details:      
 
Domain Number 2 Region: 133-197
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.08e-19
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603205|ref|NP_246279.1|
Sequence length 199
Comment UhpA family transcriptional regulator [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIKVALIDDHIIVRSGFAQLLALENDLHVVGEFSSAKEARQHLPSVRPDVCIIDISMPDE
TGLALLKDIPSGIHCIMLSVNDSDIMVRKALELGAKGYLSKRCHPDELIQAVHAVFAGGL
YLMPELTSKLLNPTASYTQQLTRREMEVCELLTTGLDAKEIAQQLNVSFKTVHVHRANAM
SKLNLKNNVELTNFFHQTY
Download sequence
Identical sequences A0A1E3XLB4 Q9CL99
272843.PM1340 gi|15603205|ref|NP_246279.1| gi|383311595|ref|YP_005364405.1| WP_005723942.1.11214 WP_005723942.1.11947 WP_005723942.1.12156 WP_005723942.1.12311 WP_005723942.1.14908 WP_005723942.1.15732 WP_005723942.1.17980 WP_005723942.1.19996 WP_005723942.1.21657 WP_005723942.1.26777 WP_005723942.1.27592 WP_005723942.1.28084 WP_005723942.1.35562 WP_005723942.1.3807 WP_005723942.1.38246 WP_005723942.1.3839 WP_005723942.1.3957 WP_005723942.1.40210 WP_005723942.1.41297 WP_005723942.1.41351 WP_005723942.1.41667 WP_005723942.1.4211 WP_005723942.1.42512 WP_005723942.1.43687 WP_005723942.1.45422 WP_005723942.1.4808 WP_005723942.1.49053 WP_005723942.1.51342 WP_005723942.1.52585 WP_005723942.1.52859 WP_005723942.1.53852 WP_005723942.1.55401 WP_005723942.1.57956 WP_005723942.1.58111 WP_005723942.1.58257 WP_005723942.1.60478 WP_005723942.1.61098 WP_005723942.1.6219 WP_005723942.1.62389 WP_005723942.1.6332 WP_005723942.1.63549 WP_005723942.1.66990 WP_005723942.1.70689 WP_005723942.1.72215 WP_005723942.1.78987 WP_005723942.1.79347 WP_005723942.1.79593 WP_005723942.1.81885 WP_005723942.1.8281 WP_005723942.1.83579 WP_005723942.1.88402 WP_005723942.1.89773 WP_005723942.1.92478 WP_005723942.1.93940 WP_005723942.1.94432 WP_005723942.1.9746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]