SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603207|ref|NP_246281.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603207|ref|NP_246281.1|
Domain Number 1 Region: 1-307
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.24e-65
Family Tyrosine-dependent oxidoreductases 0.000000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603207|ref|NP_246281.1|
Sequence length 310
Comment ADP-L-glycero-D-manno-heptose-6-epimerase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIIVTGGAGFIGSNIVKALNELGRTDILVVDNLKDGTKFANLVDLDIADYCDKEDFIASI
IAGDDLGDIEVIFHEGACSATTEWDGKYIMHNNYEYSKELLHYCLDREIPFFYASSAATY
GDKTEFREEREFEAPLNVYGYSKFLFDQYVRAILPEANSPVCGFRYFNVYGPRENHKGAM
ASVAFHLNNQILKGEKPKLFAGSEHFRRDFVYVGDVAAVNIWCWQNNISGIYNLGTGNAE
SFLEVAKAVVKFHGKTEADIEIIPFPEHLKSRYQEYTQANLDKLRATGYDKPFKTVAQGV
AEYMAWLNRK
Download sequence
Identical sequences A0A1D7R4L4 A0A2K2YL49 Q9CL97 V4MSP5
gi|378775589|ref|YP_005177832.1| WP_005723946.1.10027 WP_005723946.1.10721 WP_005723946.1.11014 WP_005723946.1.11214 WP_005723946.1.11947 WP_005723946.1.12311 WP_005723946.1.1307 WP_005723946.1.14908 WP_005723946.1.15732 WP_005723946.1.17217 WP_005723946.1.17980 WP_005723946.1.18123 WP_005723946.1.19996 WP_005723946.1.20287 WP_005723946.1.21657 WP_005723946.1.22153 WP_005723946.1.2313 WP_005723946.1.23830 WP_005723946.1.24757 WP_005723946.1.26616 WP_005723946.1.26777 WP_005723946.1.27416 WP_005723946.1.27592 WP_005723946.1.27664 WP_005723946.1.28084 WP_005723946.1.29697 WP_005723946.1.30617 WP_005723946.1.34253 WP_005723946.1.35562 WP_005723946.1.35978 WP_005723946.1.36022 WP_005723946.1.3807 WP_005723946.1.38246 WP_005723946.1.3839 WP_005723946.1.39152 WP_005723946.1.3957 WP_005723946.1.40210 WP_005723946.1.40787 WP_005723946.1.41297 WP_005723946.1.41351 WP_005723946.1.41462 WP_005723946.1.41657 WP_005723946.1.41667 WP_005723946.1.42469 WP_005723946.1.42512 WP_005723946.1.42943 WP_005723946.1.43687 WP_005723946.1.44741 WP_005723946.1.45422 WP_005723946.1.47685 WP_005723946.1.4808 WP_005723946.1.49053 WP_005723946.1.50853 WP_005723946.1.51342 WP_005723946.1.52066 WP_005723946.1.52585 WP_005723946.1.52859 WP_005723946.1.53852 WP_005723946.1.55074 WP_005723946.1.55401 WP_005723946.1.57420 WP_005723946.1.57956 WP_005723946.1.58111 WP_005723946.1.58257 WP_005723946.1.58450 WP_005723946.1.58628 WP_005723946.1.58910 WP_005723946.1.59455 WP_005723946.1.60664 WP_005723946.1.61098 WP_005723946.1.61860 WP_005723946.1.62016 WP_005723946.1.6219 WP_005723946.1.62389 WP_005723946.1.6332 WP_005723946.1.63549 WP_005723946.1.65482 WP_005723946.1.65878 WP_005723946.1.66934 WP_005723946.1.66990 WP_005723946.1.70689 WP_005723946.1.72215 WP_005723946.1.73917 WP_005723946.1.74955 WP_005723946.1.75804 WP_005723946.1.78987 WP_005723946.1.79347 WP_005723946.1.79593 WP_005723946.1.80223 WP_005723946.1.80589 WP_005723946.1.80911 WP_005723946.1.81885 WP_005723946.1.8281 WP_005723946.1.83579 WP_005723946.1.86541 WP_005723946.1.87897 WP_005723946.1.88402 WP_005723946.1.89773 WP_005723946.1.90081 WP_005723946.1.90179 WP_005723946.1.90578 WP_005723946.1.91495 WP_005723946.1.92478 WP_005723946.1.93940 WP_005723946.1.94432 WP_005723946.1.94435 WP_005723946.1.95718 WP_005723946.1.9746 WP_005723946.1.9947 gi|383311597|ref|YP_005364407.1| gi|15603207|ref|NP_246281.1| gi|386835649|ref|YP_006240969.1| 272843.PM1342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]