SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603211|ref|NP_246285.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603211|ref|NP_246285.1|
Domain Number 1 Region: 88-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-40
Family Phosphate binding protein-like 0.000000152
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.57e-22
Family LysR-like transcriptional regulators 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603211|ref|NP_246285.1|
Sequence length 298
Comment DNA-binding transcriptional regulator OxyR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNIRDLEYLVALAEHKHFRRAADACHVSQPTLSGQIRKLEDELGIILLERTSRKVLFTQS
GLLLVDQAKNVLKEVKLLKEMASNQGKDMTGPIHIGVIPTVGPYLLPYIMPVLKETFPDL
ELFLYEAQTNQLLEQLETGHLDCAIVASVRETEAFIEVPIFHEAMLLAVSENHPWANERT
IAMNRLNGCEMLMLDDGHCLRDQTIGYCFSAGAKENAHFQATSLETLRNMVASNTGITLM
PKLAVINEGNRTGVKYIPCHSPAPSRAITLVYRPGSPLRNRYEKIAQTISHSVQDVLD
Download sequence
Identical sequences A0A1E3XLE9 A0A2K2YL77 Q9CL94
gi|386835645|ref|YP_006240965.1| WP_005723950.1.11014 WP_005723950.1.11214 WP_005723950.1.11947 WP_005723950.1.12156 WP_005723950.1.12311 WP_005723950.1.14908 WP_005723950.1.15732 WP_005723950.1.17980 WP_005723950.1.19996 WP_005723950.1.24757 WP_005723950.1.27592 WP_005723950.1.27664 WP_005723950.1.28084 WP_005723950.1.35562 WP_005723950.1.3807 WP_005723950.1.38246 WP_005723950.1.3839 WP_005723950.1.3957 WP_005723950.1.40210 WP_005723950.1.40787 WP_005723950.1.41297 WP_005723950.1.41351 WP_005723950.1.41657 WP_005723950.1.41667 WP_005723950.1.42469 WP_005723950.1.42512 WP_005723950.1.43687 WP_005723950.1.45422 WP_005723950.1.4808 WP_005723950.1.49053 WP_005723950.1.52585 WP_005723950.1.52859 WP_005723950.1.53852 WP_005723950.1.55074 WP_005723950.1.55401 WP_005723950.1.57956 WP_005723950.1.58111 WP_005723950.1.58257 WP_005723950.1.60478 WP_005723950.1.61098 WP_005723950.1.6219 WP_005723950.1.62389 WP_005723950.1.6332 WP_005723950.1.63549 WP_005723950.1.66990 WP_005723950.1.70689 WP_005723950.1.72215 WP_005723950.1.78987 WP_005723950.1.79347 WP_005723950.1.79593 WP_005723950.1.81885 WP_005723950.1.8281 WP_005723950.1.83579 WP_005723950.1.88402 WP_005723950.1.89773 WP_005723950.1.90578 WP_005723950.1.92478 WP_005723950.1.93940 WP_005723950.1.94432 WP_005723950.1.9746 WP_005723950.1.9947 gi|383311601|ref|YP_005364411.1| 272843.PM1346 gi|15603211|ref|NP_246285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]