SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603214|ref|NP_246288.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603214|ref|NP_246288.1|
Domain Number 1 Region: 30-233
Classification Level Classification E-value
Superfamily FKBP-like 1.53e-54
Family FKBP immunophilin/proline isomerase 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603214|ref|NP_246288.1|
Sequence length 238
Comment SlyD protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFKIQKLSLITLVVSAVISGNALANTDAKFNDEASYAVGVLLGSNVKQIVESQKGIIEYD
NTRLLAGVQDVLNGKVDLDSNEQIAQTLQRVQEKMQQAQAQLLADIAKQAKQDGDQYRQT
FEKKAGAKKTQSGLLYRIEQAGTGNTIKPTDTVTVNYTGKLPNGEVFDSSRGKPVSFKLN
QVVPGWTEGLQLVKKGGKIELVLPPELAYGEQGAGQIPPNATLHFDVEVIDVKADTQK
Download sequence
Identical sequences Q9CL91
WP_010907136.1.12311 WP_010907136.1.15732 WP_010907136.1.19996 WP_010907136.1.40210 WP_010907136.1.45422 WP_010907136.1.4808 WP_010907136.1.53852 WP_010907136.1.6219 WP_010907136.1.62389 WP_010907136.1.66990 WP_010907136.1.81885 WP_010907136.1.8281 WP_010907136.1.89773 WP_010907136.1.9746 WP_010907136.1.9947 gi|15603214|ref|NP_246288.1| 272843.PM1349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]