SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603216|ref|NP_246290.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603216|ref|NP_246290.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily DsrEFH-like 6.83e-31
Family DsrEF-like 0.0000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603216|ref|NP_246290.1|
Sequence length 126
Comment sulfur transfer complex subunit TusD [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRYVLCVKQPAYGKQGGFLAYQLAKALLEKGHQITQVFFFQEGVTHGNAFLYPASDEFNL
QHAWQRLAQDYHVPLHLCVAAAQRRGVVEPLTSSTTQQNNLASCFVLAGLGEFMKASLEA
DRVVCL
Download sequence
Identical sequences A0A2J9QRL0 A0A2K2YL40 Q9CL89 V4MSN9
gi|383311606|ref|YP_005364416.1| WP_005723957.1.11214 WP_005723957.1.11947 WP_005723957.1.12156 WP_005723957.1.12311 WP_005723957.1.15732 WP_005723957.1.19996 WP_005723957.1.21657 WP_005723957.1.23830 WP_005723957.1.24757 WP_005723957.1.26777 WP_005723957.1.27416 WP_005723957.1.27592 WP_005723957.1.27664 WP_005723957.1.28084 WP_005723957.1.35562 WP_005723957.1.36022 WP_005723957.1.3807 WP_005723957.1.38246 WP_005723957.1.3839 WP_005723957.1.40210 WP_005723957.1.40787 WP_005723957.1.41297 WP_005723957.1.41351 WP_005723957.1.41657 WP_005723957.1.41667 WP_005723957.1.42512 WP_005723957.1.43687 WP_005723957.1.45422 WP_005723957.1.4808 WP_005723957.1.49053 WP_005723957.1.51342 WP_005723957.1.52859 WP_005723957.1.53852 WP_005723957.1.55074 WP_005723957.1.55401 WP_005723957.1.57956 WP_005723957.1.58111 WP_005723957.1.58257 WP_005723957.1.60478 WP_005723957.1.6219 WP_005723957.1.62389 WP_005723957.1.6332 WP_005723957.1.63549 WP_005723957.1.66990 WP_005723957.1.70689 WP_005723957.1.72215 WP_005723957.1.74955 WP_005723957.1.75804 WP_005723957.1.78987 WP_005723957.1.79347 WP_005723957.1.79593 WP_005723957.1.81885 WP_005723957.1.8281 WP_005723957.1.83579 WP_005723957.1.88402 WP_005723957.1.89773 WP_005723957.1.92478 WP_005723957.1.93940 WP_005723957.1.94432 WP_005723957.1.95718 WP_005723957.1.9746 WP_005723957.1.9947 gi|15603216|ref|NP_246290.1| gi|386835640|ref|YP_006240960.1| 272843.PM1351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]