SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603217|ref|NP_246291.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603217|ref|NP_246291.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily DsrEFH-like 9.08e-32
Family DsrEF-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603217|ref|NP_246291.1|
Sequence length 119
Comment sulfur relay protein TusC [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKLAFVFRSTPFGRASTREGLDALLAATAFCDEQDIAVFFLDDGVFSLLNHQDPAQILQK
DVVNMFKLLDLYDIEQRYICLESLATAKMTASDCIITCEKMARAALLTLLGKAERVLTF
Download sequence
Identical sequences A0A1D2NNR6 Q9CL88
gi|15603217|ref|NP_246291.1| 272843.PM1352 WP_005751978.1.11214 WP_005751978.1.11947 WP_005751978.1.12156 WP_005751978.1.12311 WP_005751978.1.14908 WP_005751978.1.15732 WP_005751978.1.17980 WP_005751978.1.19996 WP_005751978.1.21657 WP_005751978.1.24757 WP_005751978.1.26777 WP_005751978.1.28084 WP_005751978.1.35562 WP_005751978.1.3807 WP_005751978.1.38246 WP_005751978.1.3839 WP_005751978.1.3957 WP_005751978.1.40210 WP_005751978.1.40787 WP_005751978.1.43687 WP_005751978.1.45422 WP_005751978.1.4808 WP_005751978.1.49053 WP_005751978.1.51342 WP_005751978.1.52585 WP_005751978.1.52859 WP_005751978.1.53852 WP_005751978.1.55074 WP_005751978.1.55401 WP_005751978.1.58257 WP_005751978.1.60478 WP_005751978.1.61098 WP_005751978.1.6219 WP_005751978.1.62389 WP_005751978.1.6332 WP_005751978.1.63549 WP_005751978.1.66990 WP_005751978.1.72215 WP_005751978.1.78987 WP_005751978.1.79347 WP_005751978.1.79593 WP_005751978.1.81885 WP_005751978.1.8281 WP_005751978.1.83579 WP_005751978.1.89773 WP_005751978.1.9746 WP_005751978.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]