SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603218|ref|NP_246292.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603218|ref|NP_246292.1|
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily DsrEFH-like 1.06e-18
Family DsrH-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603218|ref|NP_246292.1|
Sequence length 95
Comment hypothetical protein PM1353 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLYTFAEASYPEGVLLTYLQQTTSQDAIVLWQDGVYLCVKYPEVFSSLNTSCYALDIDVG
ARNLYQFVSSIENVKTISLTELVELTEQYFPQLAL
Download sequence
Identical sequences Q9CL87 V4NGF6
gi|15603218|ref|NP_246292.1| 272843.PM1353 WP_010907137.1.12311 WP_010907137.1.15732 WP_010907137.1.19996 WP_010907137.1.23830 WP_010907137.1.27416 WP_010907137.1.40210 WP_010907137.1.45422 WP_010907137.1.4808 WP_010907137.1.53852 WP_010907137.1.6219 WP_010907137.1.62389 WP_010907137.1.66990 WP_010907137.1.74955 WP_010907137.1.75804 WP_010907137.1.81885 WP_010907137.1.8281 WP_010907137.1.89773 WP_010907137.1.9746 WP_010907137.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]